spacer

EBI Dbfetch

LOCUS       NC_004952               3990 bp    DNA     circular CON 23-MAY-2013
DEFINITION  Francisella novicida plasmid pFNL10, complete sequence.
ACCESSION   NC_004952
VERSION     NC_004952.1  GI:32455353
DBLINK      Project: 187724
            BioProject: PRJNA187724
KEYWORDS    RefSeq.
SOURCE      Francisella tularensis subsp. novicida (Francisella novicida)
  ORGANISM  Francisella tularensis subsp. novicida
            Bacteria; Proteobacteria; Gammaproteobacteria; Thiotrichales;
            Francisellaceae; Francisella.
REFERENCE   1  (bases 1 to 3990)
  AUTHORS   Pomerantsev,A.P., Golovliov,I.R., Ohara,Y., Mokrievich,A.N.,
            Obuchi,M., Norqvist,A., Kuoppa,K. and Pavlov,V.M.
  TITLE     Genetic organization of the Francisella plasmid pFNL10
  JOURNAL   Plasmid 46 (3), 210-222 (2001)
   PUBMED   11735370
REFERENCE   2  (bases 1 to 3990)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JAN-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3990)
  AUTHORS   Pomerantsev,A.P., Golovliov,I.R., Mokrievish,A.N. and Pavlov,V.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-1999) Microbiology, State Research Center for
            Applied Microbiology, Obolensk, Moscow Region 142279, Russia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AF121418.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3990
                     /organism="Francisella tularensis subsp. novicida"
                     /mol_type="genomic DNA"
                     /strain="F6168"
                     /sub_species="novicida"
                     /db_xref="taxon:264"
                     /plasmid="pFNL10"
     terminator      complement(24..200)
     gene            complement(180..602)
                     /locus_tag="pFNL10_p1"
                     /db_xref="GeneID:4267387"
     CDS             complement(180..602)
                     /locus_tag="pFNL10_p1"
                     /note="orf2"
                     /codon_start=1
                     /transl_table=11
                     /product="RepB protein"
                     /protein_id="NP_862365.1"
                     /db_xref="GI:32455354"
                     /db_xref="GeneID:4267387"
                     /translation="MNIEIFKFSKKHKKINKKLIDLTKVKQVVTTGYSFIVVYQRGRK
                     IELSYESSYWHAKKDLDNSNSDVGITYSYIKKDKRGPCHKDNYLRDSKGRLLKDWGKI
                     EELHEKYPKIGKIWYISREETDKLLKDFTYKNGNLIMV"
     gene            complement(605..1682)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
                     /db_xref="GeneID:1343173"
     CDS             complement(605..1624)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
                     /note="orf1"
                     /codon_start=1
                     /transl_table=11
                     /product="RepA protein"
                     /protein_id="NP_862366.1"
                     /db_xref="GI:32455355"
                     /db_xref="GeneID:1343173"
                     /translation="MKEVKNVNAGKEIAMSNTLVAGKYSLTKEEQNLIFLVASMVKRE
                     DKEFHRYKISLSDLEKATGVKHNRVRLKQLMHSIMSKPVWLNKEQTKIANWFAYIEAD
                     PKSSALICEFHWSLMPHMIQLQEYFTKAERQLLFSFKSKYSSRLYLLLKSKLGEQAGY
                     ANIVDCVLYVDDMINDFDLPKSYSNRYSNFKNKFLLPALEEINQLSDIFVTYDDKDHH
                     RKHGRKITNIKFTVSKVAETEEEFKQKLLDTKNKEDYIPIEASERLREVVLSDELDLD
                     LYYVRSIFRHHHLHDIERVCDDTWRNWDNKKIKDRKRVFIANIKKLEKKPEENHKLPF
                     GFEEV"
     misc_feature    complement(1647)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
                     /note="transcription start site"
     -10_signal      complement(1654..1659)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
     -35_signal      complement(1677..1682)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
     repeat_region   1711..1795
                     /rpt_type=tandem
     repeat_region   1860..1890
                     /rpt_type=tandem
     gene            1933..2252
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
                     /db_xref="GeneID:1343174"
     -35_signal      1933..1938
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
     -10_signal      1956..1961
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
     misc_feature    1968
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
                     /note="transcription start site"
     CDS             1995..2252
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
                     /note="orf5"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Phd protein"
                     /protein_id="NP_862367.1"
                     /db_xref="GI:32455356"
                     /db_xref="GeneID:1343174"
                     /translation="MQTVNYSTFRNELSDSMDRVTKNHSPMIVTRGSKKEAVVMMSLE
                     DFKAYEETAYLMRSMNNYKRLQNSIDEVESGLAIQKELIEE"
     gene            2249..2455
                     /locus_tag="pFNL10_p4"
                     /db_xref="GeneID:4267388"
     CDS             2249..2455
                     /note="orf4"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Doc protein"
                     /protein_id="NP_862368.1"
                     /db_xref="GI:32455357"
                     /translation="MILSWSTNAWEDYLYWQSIDKKKLKRINLLIKDIMRNHFEGLGE
                     PEPLKHNFSGYWSRRIDKEHLNNL"
     repeat_region   2479..2502
                     /rpt_type=tandem
     terminator      2519..2570
     gene            2616..2786
                     /locus_tag="pFNL10_p5"
                     /db_xref="GeneID:4267390"
     CDS             2616..2786
                     /locus_tag="pFNL10_p5"
                     /note="orfm"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_862369.1"
                     /db_xref="GI:32455359"
                     /db_xref="GeneID:4267390"
                     /translation="MTECRIKPRAIAHGKIDYHLLLKCFSDGVNINTLMCYSSLVELL
                     SNYWFYQPVTKY"
     misc_feature    3060
                     /note="transcription start site"
     gene            3075..3953
                     /locus_tag="pFNL10_p6"
                     /db_xref="GeneID:4267389"
     CDS             3075..3953
                     /locus_tag="pFNL10_p6"
                     /note="orf3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_862370.1"
                     /db_xref="GI:32455358"
                     /db_xref="GeneID:4267389"
                     /translation="MKDKAAKNRDFRKTILSVLQRNKDGSFATQANRKSILLQATKDL
                     KKVGFSKVTAENFGNKHCYALRDHWRAQGLATATIKNRLACLRWLGEKMGKELPDNRK
                     LEIENRKYSDNSINKAQEIDFKAISALTDRQALAIQLQREFGLRREESLKFQPSYAIK
                     EHKIELKSSWTKVGRPREIPILNEKQRELLEKVKEVAGKGSLIESEKSYKQAMEHFTT
                     RCQRAGIKNVHGFRHAYAQDRYRQLTGRECPKNGGLTSKQLTPEQKQQDYEARMTISE
                     ELGHGREDVTVNYLGR"
CONTIG      join(AF121418.1:1..3990)
//



spacer
spacer