spacer

EBI Dbfetch

LOCUS       AC_000022              16300 bp    DNA     circular ROD 28-AUG-2012
DEFINITION  Rattus norvegicus strain Wistar mitochondrion, complete genome.
ACCESSION   AC_000022
VERSION     AC_000022.2  GI:110189662
DBLINK      Project: 12455
            BioProject: PRJNA12455
KEYWORDS    RefSeq.
SOURCE      mitochondrion Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 16300)
  AUTHORS   Gadaleta,G., Pepe,G., De Candia,G., Quagliariello,C., Sbisa,E. and
            Saccone,C.
  TITLE     The complete nucleotide sequence of the Rattus norvegicus
            mitochondrial genome: cryptic signals revealed by comparative
            analysis between vertebrates
  JOURNAL   J. Mol. Evol. 28 (6), 497-516 (1989)
   PUBMED   2504926
REFERENCE   2  (bases 1 to 16300)
  AUTHORS   Grosskopf,R. and Feldmann,H.
  TITLE     tRNA genes in rat liver mitochondrial DNA
  JOURNAL   Curr. Genet. 4 (3), 191-196 (1981)
   PUBMED   24185992
REFERENCE   3  (bases 1 to 16300)
  AUTHORS   Grosskopf,R. and Feldmann,H.
  TITLE     Analysis of a DNA segment from rat liver mitochondria containing
            the genes for the cytochrome oxidase subunits I, II and III, ATPase
            subunit 6, and several tRNA genes
  JOURNAL   Curr. Genet. 4 (2), 151-158 (1981)
   PUBMED   24185961
REFERENCE   4  (bases 1 to 16300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUN-2008) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 16300)
  AUTHORS   Saccone,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-1995) Dipartimento di Biochimica e Biologia
            Molacolare, Via Amendola 165/A, 70126 Bari, Italy
REFERENCE   6  (bases 1 to 16300)
  AUTHORS   Saccone,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAR-1989) Dipartimento di Biochimica e Biologia
            Molacolare, Via Amendola 165/A, 70126 Bari, Italy
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from X14848.
            On Jul 6, 2006 this sequence version replaced gi:58615676.
            Sequence Note:  NC_001665.2 represents the reference sequence for
            the rat mitochondrial genome. In July 2006 the underlying sequence
            was updated to represent the Brown Norway strain based on the
            recommendation of the Rat Genome Sequencing Consortium that
            BN/SsNHsdMCW should be the reference sequence.  In conjunction with
            this update, an alternate accession AC_000022.2 was updated to
            continue to represent the the Wistar strain sequence that was
            previously considered to be the reference standard.
            for seqs get included see V00681, K00434, J01436, X07479, X07482.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..16300
                     /organism="Rattus norvegicus"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /strain="Wistar"
                     /db_xref="taxon:10116"
                     /clone="pSF2124."
     tRNA            1..67
                     /product="tRNA-Phe"
     rRNA            69..1025
                     /product="s-rRNA"
                     /note="12S ribosomal RNA"
     STS             901..1616
                     /standard_name="PMC316374P5"
                     /db_xref="UniSTS:272966"
     tRNA            1026..1094
                     /product="tRNA-Val"
     rRNA            1095..2653
                     /product="l-rRNA"
                     /note="16S ribosomal RNA"
     STS             2340..2525
                     /standard_name="RH136367"
                     /db_xref="UniSTS:210357"
     tRNA            2654..2728
                     /product="tRNA-Leu"
                     /codon_recognized="UUR"
     gene            2729..3685
                     /gene="ND1"
                     /db_xref="GeneID:7066247"
     CDS             2729..3685
                     /gene="ND1"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 1"
                     /protein_id="AP_004892.1"
                     /db_xref="GI:110189663"
                     /db_xref="GOA:P03889"
                     /db_xref="InterPro:IPR001694"
                     /db_xref="UniProtKB/Swiss-Prot:P03889"
                     /db_xref="GeneID:7066247"
                     /translation="MYFINILTLLIPILIAMGLLTLVERKILGYMQLRKGPNNEGPYG
                     KLQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWIPLPMPHPLINLNLGM
                     PFILATSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMALYLLSVLLMSGSF
                     SLQMLITTQEHIWLLIPAWPMAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAG
                     PFALFFMAEYTNIILMNALTSIVFLGPLYHINYPELYSTSFMTETLLLSTTFLWIRAS
                     YPRFRYDQLMHLLWKNFLPLTLAFCMWYISLPIFLAGIPPYT"
     tRNA            3684..3752
                     /product="tRNA-Ile"
     tRNA            complement(3750..3820)
                     /product="tRNA-Gln"
     tRNA            3824..3891
                     /product="tRNA-Met"
     gene            3892..4929
                     /gene="ND2"
                     /db_xref="GeneID:7066248"
     CDS             3892..4929
                     /gene="ND2"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 2"
                     /protein_id="AP_004893.1"
                     /db_xref="GI:110189664"
                     /db_xref="GOA:P11662"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="InterPro:IPR001750"
                     /db_xref="InterPro:IPR003917"
                     /db_xref="InterPro:IPR010933"
                     /db_xref="UniProtKB/Swiss-Prot:P11662"
                     /db_xref="GeneID:7066248"
                     /translation="MNPITLTIIYLTTFKGRLITTLSTNLPPMWVGLEMSLLAIIPLL
                     ANKKSPRSTEAATKYFLTQATASMIILLVIILNYKQSGMWTLQQQTNNMLLNMMLISL
                     AMKLGLAPFHYWLPEVTQGIPLHIGLILLTWQKIAPLSILYQFYQLLNPTITTILAIS
                     SVFVGAWGGLNQTQTRKIMAYSSIAHMGWMTAILPYNPNLTLLNLTIYILLTVPMFNY
                     IMTNSATTINTLSLAWNKTPMILTMASIILLSLGGLPPLTGFLPKWAIISELLKNNCS
                     TLSTLMAIMALLSLFFYTRLIYSMSLTTFPTNNNSKMISHHQNPKHNFILPTLTVLST
                     LTLPLSSQLIT"
     tRNA            4928..4993
                     /product="tRNA-Trp"
     tRNA            complement(4995..5063)
                     /product="tRNA-Ala"
     tRNA            complement(5066..5139)
                     /product="tRNA-Asn"
     rep_origin      5140..5170
                     /note="origin of light strand replication"
     tRNA            complement(5171..5238)
                     /product="tRNA-Cys"
     tRNA            complement(5242..5307)
                     /product="tRNA-Tyr"
     gene            5309..6853
                     /gene="COX1"
                     /db_xref="GeneID:7066249"
     CDS             5309..6853
                     /gene="COX1"
                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="AP_004894.1"
                     /db_xref="GI:110189665"
                     /db_xref="GOA:P05503"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="UniProtKB/Swiss-Prot:P05503"
                     /db_xref="GeneID:7066249"
                     /translation="MFVNRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQP
                     GALLGDDQIYNVIVTAHAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSF
                     WLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGVSVDLTIFSLHLAGVSSILG
                     AINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTT
                     FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWT
                     MMSIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKW
                     SPAMLWALGFIFLFTVGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAG
                     FVHWFPLFSGYTLNDTWAKAHFAIMFVGVNMTFFPQHFLGLAGMPRRYSDYPDAYTTW
                     NTVSSMGSFISLTAVLVMIFMIWEAFASKREVLSISYSSTNLEWLHGCPPPYHTFEEP
                     SYVKVK"
     tRNA            complement(6850..6919)
                     /product="tRNA-Ser"
                     /codon_recognized="UCN"
     tRNA            6922..6989
                     /product="tRNA-Asp"
     gene            6991..7674
                     /gene="COX2"
                     /db_xref="GeneID:7066250"
     CDS             6991..7674
                     /gene="COX2"
                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="AP_004895.1"
                     /db_xref="GI:110189666"
                     /db_xref="GOA:P00406"
                     /db_xref="InterPro:IPR001505"
                     /db_xref="InterPro:IPR002429"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="UniProtKB/Swiss-Prot:P00406"
                     /db_xref="GeneID:7066250"
                     /translation="MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISL
                     MLTTKLTHTSTMDAQEVETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGH
                     QWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVL
                     HSWAIPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKY
                     FENWSASMI"
     tRNA            7678..7741
                     /product="tRNA-Lys"
     gene            7743..7946
                     /gene="ATP8"
                     /db_xref="GeneID:7066251"
     CDS             7743..7946
                     /gene="ATP8"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 8"
                     /protein_id="AP_004896.1"
                     /db_xref="GI:110189667"
                     /db_xref="GOA:P11608"
                     /db_xref="InterPro:IPR001421"
                     /db_xref="UniProtKB/Swiss-Prot:P11608"
                     /db_xref="GeneID:7066251"
                     /translation="MPQLDTSTWFITIISSMATLFILFQLKISSQTFPAPPSPKTMAT
                     EKTNNPWESKWTKIYLPLSLPPQ"
     gene            7904..8584
                     /gene="ATP6"
                     /db_xref="GeneID:7066252"
     CDS             7904..8584
                     /gene="ATP6"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 6"
                     /protein_id="AP_004897.1"
                     /db_xref="GI:110189668"
                     /db_xref="GOA:P05504"
                     /db_xref="InterPro:IPR000568"
                     /db_xref="UniProtKB/Swiss-Prot:P05504"
                     /db_xref="GeneID:7066252"
                     /translation="MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISNRLHS
                     FQHWLIKLIIKQMMLIHTPKGRTWALMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMDL
                     SMAIPLWAGAVILGFRHKLKNSLAHFSPQGTPISLIPMLIIIETISLFIQPMALAVRL
                     TANITAGHLLMHLIGGATLVLMDISPPTATITFIILLLLTVLEFAVALIQAYVFTLLV
                     SLYLHDNT"
     gene            8584..9367
                     /gene="COX3"
                     /db_xref="GeneID:7066253"
     CDS             8584..9367
                     /gene="COX3"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:9367,aa:TERM)
                     /transl_table=2
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="AP_004898.1"
                     /db_xref="GI:110189669"
                     /db_xref="GOA:P05505"
                     /db_xref="UniProtKB/Swiss-Prot:P05505"
                     /db_xref="GeneID:7066253"
                     /translation="MTHQTHAYHMVNPSPWPLTGALSALLLTSGLVMWFHYNSTILLS
                     LGLLTNILTMYQWWRDIIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFY
                     HSSLVPTHDLGGCWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRNHMN
                     QALLITILLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVC
                     LLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
     tRNA            9368..9435
                     /product="tRNA-Gly"
     gene            9436..9783
                     /gene="ND3"
                     /db_xref="GeneID:7066254"
     CDS             9436..9783
                     /gene="ND3"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 3"
                     /protein_id="AP_004899.1"
                     /db_xref="GI:110189670"
                     /db_xref="GOA:P05506"
                     /db_xref="InterPro:IPR000440"
                     /db_xref="UniProtKB/Swiss-Prot:P05506"
                     /db_xref="GeneID:7066254"
                     /translation="MNLPIIITINITLSFILISIAFWLPQMNLYSEKANPYECGFDPT
                     SSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTTNTTTMMATAFILVTILSLGL
                     AYEWTQKGLEWTE"
     tRNA            9785..9852
                     /product="tRNA-Arg"
     gene            9855..10151
                     /gene="ND4L"
                     /db_xref="GeneID:7066255"
     CDS             9855..10151
                     /gene="ND4L"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4L"
                     /protein_id="AP_004900.1"
                     /db_xref="GI:110189671"
                     /db_xref="GOA:P05507"
                     /db_xref="UniProtKB/Swiss-Prot:P05507"
                     /db_xref="GeneID:7066255"
                     /translation="MTSAFLNLTMAFTLSLLGTFMFRSHLMSTLLCLEGMMLSLFVMT
                     STSTLNSNSMISMTIPITILVFAACEAAVGLALLVKISNTYGTDYVQNLNLLQC"
     gene            10145..11522
                     /gene="ND4"
                     /db_xref="GeneID:7066256"
     CDS             10145..11522
                     /gene="ND4"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:11522,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4"
                     /protein_id="AP_004901.1"
                     /db_xref="GI:110189672"
                     /db_xref="GOA:P05508"
                     /db_xref="InterPro:IPR000260"
                     /db_xref="InterPro:IPR001750"
                     /db_xref="InterPro:IPR003918"
                     /db_xref="InterPro:IPR010227"
                     /db_xref="UniProtKB/Swiss-Prot:P05508"
                     /db_xref="GeneID:7066256"
                     /translation="MLKIIFPSIMLLPLTWLSANKKIWTNVTSYSFLVSLLSLSLLWQ
                     NDENYLNFSVMFSSDPLSTPLIILTTWLLPLMMLASQNHMKKENMMHQKLYISMLISL
                     QILLIMTFSATELILFYILFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPL
                     LIALISIQNSMGTLNFLILSLTTHPLPSTWSNTILWLACMMAFMIKMPLYGVHLWLPK
                     AHVEAPIAGSMILAAILLKLGGYGMMRVSIILDPLTKSLAYPFIILSLWGMIMTSSIC
                     LRQTDLKSLIAYSSVSHMALVITAIMIQTPWSFMGATMLMIAHGLTSSLLFCLANTNY
                     ERIHSRTMIMARGLQMIFPLMATWWLLASLANLALPPLINLMGELFIVMATFSWSNPS
                     IILMATNIVITGMYSMYMIITTQRGKLTSHMNNLQPSHTRELTLMALHIIPLMLLTIN
                     PKLITGLTM"
     tRNA            11523..11590
                     /product="tRNA-His"
     tRNA            11591..11650
                     /product="tRNA-Ser"
                     /codon_recognized="AGY"
     tRNA            11650..11720
                     /product="tRNA-Leu"
                     /codon_recognized="CUN"
     gene            11721..13553
                     /gene="ND5"
                     /db_xref="GeneID:7066257"
     CDS             11721..13553
                     /gene="ND5"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 5"
                     /protein_id="AP_004902.1"
                     /db_xref="GI:110189673"
                     /db_xref="GOA:P11661"
                     /db_xref="InterPro:IPR001516"
                     /db_xref="InterPro:IPR001750"
                     /db_xref="InterPro:IPR003916"
                     /db_xref="InterPro:IPR003945"
                     /db_xref="InterPro:IPR010934"
                     /db_xref="UniProtKB/Swiss-Prot:P11661"
                     /db_xref="GeneID:7066257"
                     /translation="MNMMTILILMILDLLTTPITFSMTILTKLMYFRHMLITSIKFSF
                     LLSLLPLLLFFHHNTEYMITNWHWLTINSIKLTMSFKIDYFSILFLSVSLFVTWSIMQ
                     FSSWYMHSDPHINRFIKYLMMFLNNMLILTSANNLFQLFIGWEGVGIMSFLLIGWWYG
                     LADANTAALQAILYNRVGDIGFILAMTWFCLNMNSWELQQIFLTNTNNNLVPLTGLLI
                     AATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLMIRFHPLTSNNSTIMTA
                     MLCLGAITTLFTAICALTQNDIKKIVAFSTSSQLGLMMVTLGINQPYLAFLHICTHAF
                     FKAMLFMCSGSIIHILNDEQDIRKMGNMMKAMPFTSSCLIIGSLALTGMPFLTGFYSK
                     DLIIEAINTCNTNAWALMITLIATSMTAVYSMRIIYFVTMTKPRYSPLITINENNPNL
                     INPIKRLALGSILAGFLISLNIPPTNIQILTMPWHLKMTALLITILGFAIALELNNLT
                     LNLSMSKPTKLSSFSTSLGYYPPIMPRIIPQKTLNSSYKLSLNLLDLIWSEKTIPKST
                     SITQTQLSKMMSNQKGLIKLYFLSFLITISLIFILHTLNPEWFQ"
     gene            complement(13531..14049)
                     /gene="ND6"
                     /db_xref="GeneID:7066258"
     CDS             complement(13531..14049)
                     /gene="ND6"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 6"
                     /protein_id="AP_004903.1"
                     /db_xref="GI:110189674"
                     /db_xref="GOA:P03926"
                     /db_xref="InterPro:IPR001457"
                     /db_xref="UniProtKB/Swiss-Prot:P03926"
                     /db_xref="GeneID:7066258"
                     /translation="MTNYMFILSLLFLTGCLGLALKPSPIYGGFGLIVSGCIGCLMVL
                     GFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEEYPETWGSNWFIFSFFVLGLFMELVV
                     FYLFSLNNKVELVDFDSLGDWLMYEIDDVGVMLEGGIGVAAIYSCATWMMVVAGWSLF
                     AGIFIIIEITRD"
     tRNA            complement(14050..14118)
                     /product="tRNA-Glu"
     gene            14124..15266
                     /gene="CYTB"
                     /db_xref="GeneID:7066259"
     CDS             14124..15266
                     /gene="CYTB"
                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome b"
                     /protein_id="AP_004904.1"
                     /db_xref="GI:110189675"
                     /db_xref="GOA:P00159"
                     /db_xref="UniProtKB/Swiss-Prot:P00159"
                     /db_xref="GeneID:7066259"
                     /translation="MTNIRKSHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQ
                     ILTGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYLQANGASMFFICLFLHVGRGL
                     YYGSYTFLETWNIGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTL
                     VEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKI
                     PFHPYYTIKDLLGVFMLLLFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLF
                     AYAILRSIPNKLGGVVALILSILILAFLPFLHTSKQRSLTFRPITQILYWILVANLLV
                     LTWIGGQPVEHPFIIIGQLASISYFSIILILMPISGIVEDKMLKWN"
     tRNA            15268..15334
                     /product="tRNA-Thr"
     tRNA            complement(15336..15403)
                     /product="tRNA-Pro"
     D-loop          15404..16300
     STS             15765..16119
                     /standard_name="PMC139749P2"
                     /db_xref="UniSTS:270889"
ORIGIN      
        1 gttaatgtag cttataataa agcaaagcac tgaaaatgct tagatggatt caaaaatccc
       61 ataaacacaa aggtttggtc ctggccttat aattaattgg aggtaagatt acacatgcaa
      121 acatccataa accggtgtaa aatcccttaa agatttgcct aaaacttaag gagagggcat
      181 caagcacata atatagctca agacgccttg cctagccaca cccccacggg actcagcagt
      241 gataaatatt aagcaatgaa cgaaagtttg actaagctag tacctctcag ggttggtaaa
      301 tttcgtgcca gccaccgcgg tcatacgatt aacccaaact aattattttc ggcgtaaaac
      361 gtgccaacta taaatctcat aatagaatta aaatccaact tatatgtgaa aattcattgt
      421 taggacctaa gcccaataac gaaagtaatt ctaatcattt atataatgca cgatagctaa
      481 gacccaaact gggattagat accccactat gcttagccct aaaccttaat aattaaacct
      541 acaaaattat ttgccagaga actactagct acagcttaaa actcaaagga cttggcggta
      601 ctttatatcc atctagagga gcctgttcta taatcgataa accccgttct accttacccc
      661 ttctcgctaa ttcagcctat ataccgccat cttcagcaaa ccctaaaaag gcactaaagt
      721 aagcacaaga acaaacataa aaacgttagg tcaaggtgta gccaatgaag cggaaagaaa
      781 tgggctacat tttcttttcc cagagaacat tacgaaacct ttatgaaact aaaggacaaa
      841 ggaggattta gtagtaaatt aagaatagag agcttaattg aatagagcaa tgaagtacgc
      901 acacaccgcc cgtcaccctc ctcaaattag attgacattc acatatacat aatttcacta
      961 acaaatttat gagaggagat aagtcgtaac aaggtaagca tactggaaag tgtgcttgga
     1021 ataatcacag tgtagcttaa tcacaaagca tctggcctac acccagaaga attcataaaa
     1081 aatgaacact ttgaactaac cctagcccta caaccaacca acataactaa acccccacat
     1141 aaactaaaac atttaactca aaaagtattg gagaaagaaa tttacttacc aagagctata
     1201 gagaaagtac cgcaagggaa atgatgaaag actaatttaa agtaaaaaca agacaaagat
     1261 taaacctgta ccttttgcat aatgaattaa ctagaaaatc cttaacaaaa agaatttaag
     1321 ctaagaaccc cgaaaccaaa cgagctacct aaaaacaatt tcatgaatca acccgtctat
     1381 gtagcaaaat agtgggaaga tttttaggta gaggtgaaaa gcctatcgag cttggtgata
     1441 gctggttgcc caaaaaagaa tttcagttca aactttaagc ttccatcaga acaacaaatc
     1501 aaaatgtaaa cttaaaatat agccaaaaga gggacagctc tttaggaaac ggaaaaaacc
     1561 ttaaatagtg aataaacaac tacaatcact taaccattgt aggcttaaaa gcaagccatc
     1621 aataaagaaa gcgtcaagcc acatcatctt acacacacac taattccaca aacctcaaaa
     1681 attccaaaat tacaaattgg gctaaatcta tgatcctagt gaatactgtt aatatgtgaa
     1741 caagaaccaa tccaccaagc acaagtgcta agacaaccgg ataaccattg ttaattattg
     1801 aatcataggc ataacccaac aatagaatta cctatcccta actcgttagc ccaacacagg
     1861 cgtgctttaa ggaaagttta aaaaagtaaa ggaactcggc aaacacgaac cccgcctgtt
     1921 taccaaaaac atctcctcta gcataacaag tattagtggc atcgcctgcc cagtgactaa
     1981 agttccacgg ccgcggtatc ccgaccgtgc aaaggtagga taatcacttg ttccttaatt
     2041 agggactaga atgaatggct aaacgagggt ccaaccgtct cttacttgca atcagtgaaa
     2101 ttgaccttcc agtgaagggg cggactcata ataaaagacg agaagaccct atggagcttt
     2161 aatttactaa tttcaattta tataaaaaaa cctaatgggc gaaaacaaca aaattatgaa
     2221 ctaccaaatt tcggttgggg tgacctcgga gaataaaaaa tcctccgaat gattataacc
     2281 gagtcggtaa ccgtgtccga cccagtcaag taatactaat atcttattga cccaattatt
     2341 gatcaacgga ccaagttacc ctagggtaac agcgcgacct atttaagagt tcatatcgac
     2401 aattagggtt tacgacctcg atgttggatc aggacatccc aatggtgcag aagctattaa
     2461 tggttcgttt gttcaacgat taaagtccta cgtgatctaa gtccggcaat ccaggtcggt
     2521 ttctatctat ttacaatttc tcccagttac gaaaggacaa gagaaatgga gaccaaccaa
     2581 tcctaggctt ccaaccaatt tagaaaaact taataaagta tatatgtaca ataaataacc
     2641 ttagacccaa gttattaggg tggcagagcc aagtaattgc gtaagactta aaaccttgtt
     2701 cccagaggtt caaatcctct ccctaatagt gtactttatt aatatcctaa cactcctaat
     2761 cccaatctta attgccatag gccttctcac cctagtagaa cggaaaatcc taggctacat
     2821 acaattacgc aaaggcccca acaacgaagg cccatatggt aaactacaac catttgcaga
     2881 tgccataaaa ctattcataa aagaacccat acgccctcta accacctcaa tatcactatt
     2941 tattatcgcc ccaaccctct cccttacact agctctaagc ctatgaattc ccttaccaat
     3001 accccacccc cttatcaacc tcaacctagg cataccattt attctagcca catccagcct
     3061 ttcggtctac tccattctat gatcgggatg agcctcaaat tcaaaatact ccctattcgg
     3121 agccctacga gccgttgccc aaaccatctc ttacgaagtc acaatagcct tatacctctt
     3181 atccgtcctc ctaataagcg gctccttctc cctacaaata cttatcacta cacaagaaca
     3241 tatctgacta ttaatccccg cctgaccaat agccataata tgatacattt caaccctcgc
     3301 agaaacaaat cgagctccct tcgacttaac agaaggagaa tcagaattag tctcaggctt
     3361 taacgtcgaa tacgccgcag gaccattcgc cctattcttc atagccgagt acaccaacat
     3421 tattctaata aacgccctaa catcaattgt attcctaggc cccttatatc atatcaatta
     3481 ccctgaatta tactcaacca gcttcataac agaaacacta cttctatcca caactttcct
     3541 atggattcga gcatcctacc cccgttttcg atatgaccaa ctaatgcacc tcctatgaaa
     3601 aaatttcctc ccactaacac tagcattctg catatgatac atttccctgc caattttcct
     3661 agcaggaatt ccaccctaca catagaaata tgtctgacaa aagagttact ttgatagagt
     3721 aaataataga ggtttaaatc ctcttatttc taggacaata ggaattgaac ctacacctaa
     3781 gaattcaaaa ttctccgtgc caccaataca ccctatccta catagtaagg tcagctaact
     3841 aagctatcgg gcccataccc cgaaaatgtt ggttaaaccc ttcccgtact aataaatcca
     3901 attaccctaa ccattattta cttaaccacc tttaaaggcc gcctaatcac gacacttagc
     3961 accaacttac caccaatatg agtaggattg gaaataagcc ttttagctat catcccactt
     4021 ctagccaaca aaaaaagccc acgatcaact gaagcagcaa caaaatattt tctaacccaa
     4081 gctacagcct caataattat cctactagtc atcatcctca actacaaaca atcaggaata
     4141 tgaacccttc aacaacaaac caataacata ctactcaaca taatactcat ttcactggcc
     4201 ataaaacttg gactagcccc attccactac tgactacccg aagtcaccca aggaattccc
     4261 ctacacattg gattaatctt actaacatga caaaaaattg ctccactatc aattctatac
     4321 caattttatc aactcctaaa cccaactatc accaccattc tcgcaatttc atcagtcttt
     4381 gttggcgcct gaggaggact taaccagacc caaacacgaa aaatcatagc atactcatca
     4441 attgcccaca taggatgaat aacagcaatc cttccataca accctaactt aaccctccta
     4501 aacttaacaa tttacatcct acttactgtt ccaatattca attacatcat aacaaactca
     4561 gcaacaacaa tcaacacact ctcactcgca tgaaataaaa ctcccataat cctaaccata
     4621 gcatccatca tcctcctatc actaggagga ctcccccctc tcacaggatt tttaccaaaa
     4681 tgagcaatta tctccgagct tctaaaaaac aactgctcaa ccctatcaac actaatagct
     4741 atcatagccc tattaagcct attcttctat actcgactaa tttactctat atccctcacc
     4801 acattcccaa ccaacaacaa ctccaaaata atctcccacc accaaaaccc aaaacataat
     4861 tttatcctcc caaccctcac agtattaagt accctaaccc taccgctttc ctcccaacta
     4921 atcacataga agtttaggat atacagttca agagccttca aagcccttag aaaacaaaca
     4981 agtttaactt ctgataagga ctgtaagact atatcttaca tctgttaaat gcaaatcaac
     5041 tgctttaatt aagctaaatc ctcaactaga ttggaaggaa tcaaattcct acgaaaattt
     5101 agttaacagc taaataccct acttactggc ttcaatctac ttctcccgcc tatcagaaaa
     5161 gaggcgggag aagccttagt agaggagatt ctctacacct tcgaacttgc aattcgacat
     5221 gataatcacc ttaaggcttt ttggtaaaaa gggggctcaa cccctgtctt tagatttaca
     5281 gtctaatgct tactcagcca ttttacctat gttcgtaaac cgttgactct tttcaactaa
     5341 ccacaaagat atcggaaccc tctacctatt atttggagcc tgagcaggaa tagtagggac
     5401 agctttgagt attctaattc gagctgaact aggacagcca ggcgcactcc taggagatga
     5461 ccaaatctat aatgtcatcg tcacagccca tgcattcgta ataattttct ttatagtaat
     5521 acctataata attggaggct tcggaaactg acttgtacca ctaataattg gagcccctga
     5581 tatagcattc ccacgaataa ataacataag cttttgactg cttcctccat catttctact
     5641 ccttttagca tcctccatag tagaagctgg agctggaaca ggatgaacag tatatccccc
     5701 cttagccgga aacctagccc atgctggggt atccgtagat ttaactattt tttccctcca
     5761 cctagccggg gtgtcttcta tcttaggagc tatcaacttt atcaccacta tcattaatat
     5821 aaaaccccct gctataaccc aatatcagac acctctcttt gtatgatccg tactaattac
     5881 agccgtccta ctacttctct cactgccagt attagcagca ggtatcacta tactccttac
     5941 agaccgaaat ctaaatacta ctttcttcga ccccgctgga ggtggagacc caattcttta
     6001 tcaacaccta ttctgattct tcggccaccc agaagtgtac atcttaattc ttccagggtt
     6061 tggaattatt tcacatgtag ttacctatta ctctggaaaa aaagaaccct tcggatatat
     6121 aggtatggta tgaaccataa tatctattgg cttcctagga tttattgtat gagcacatca
     6181 catattcaca gtaggcctag atgtagacac ccgagcctac tttacatctg ccactataat
     6241 tatcgcaatt cctacaggcg taaaagtatt cagctgactc gctacactac atggaggaaa
     6301 tatcaaatga tcccccgcca tattatgagc cttagggttt atcttcttat tcacagtagg
     6361 gggcctaaca gggatcgtac tatctaactc atcccttgac attgtacttc atgatacata
     6421 ctacgtagta gctcacttcc actatgtctt atctatagga gcagtattcg ccatcatagc
     6481 tggcttcgtc cactgattcc cactattctc aggctatacc ctaaatgaca catgagcaaa
     6541 agcccacttt gccattatat ttgtaggtgt aaacataaca ttttttcctc aacacttcct
     6601 aggattagca gggatacctc gtcgttactc tgattatcca gatgcttata ccacatgaaa
     6661 tacagtctcc tctataggct cattcatctc acttacggcc gtccttgtaa tgatcttcat
     6721 gatttgagaa gccttcgcat caaaacgaga agtgctctca atttcctact cttcaactaa
     6781 cctagaatga ctgcatggat gccccccacc ttaccacaca ttcgaagaac cttcctatgt
     6841 aaaagttaaa taagaaagga aggaatcgac cccctacaac tggtttcaag ccaatttcat
     6901 aaccattatg tctttctcaa tgagatatta gtaaaataat tacataacct tgtcaaggtt
     6961 aagttataga cctaatccta tatatcttac atggcttacc catttcaact tggcttacaa
     7021 gacgctacat cacctatcat agaagaactt acaaactttc atgaccacac cctaataatt
     7081 gtattcctca tcagctccct agtactttat attatttcac taatactaac aacaaaacta
     7141 acacacacaa gcacaataga cgcccaagaa gtagaaacaa tttgaacaat tctcccagct
     7201 gtcattctta ttctaattgc ccttccctcc ctacgaattc tatacataat agacgagatt
     7261 aataacccag ttctaacagt aaaaactata ggacaccaat gatactgaag ctatgaatat
     7321 actgactatg aagacctatg ctttgactcc tacataatcc caaccaatga cctaaaacca
     7381 ggtgaacttc gtctattaga agttgataat cgggtagtct taccaataga acttccaatt
     7441 cgtatactaa tctcatccga agacgtcctg cactcatgag ccatcccttc actagggtta
     7501 aaaaccgacg caatccccgg ccgcctaaac caagctacag tcacatcaaa ccgaccaggt
     7561 ctattctatg gccaatgctc tgaaatttgc ggctcaaatc acagcttcat acccattgta
     7621 ctagaaatag tgcctctaaa atatttcgaa aactgatcag cttctataat ttaaactcat
     7681 tgcgaagctt agagcgttaa ccttttaagt taaagttaga gacaacaaat ctccacaatg
     7741 acatgccaca actagacaca tccacatgat ttattacaat catctcctca atagccacac
     7801 tatttatttt atttcaatta aaaatttctt cccaaacctt tcctgcacct ccctcaccca
     7861 aaactatagc cacagaaaaa acgaataacc cttgagaatc aaaatgaacg aaaatctatt
     7921 tgcctctttc attaccccca caataatagg tctaccaatt gttgtgacca ttattatgtt
     7981 cccatcaatt ctattcccat catcagaacg cctaatcagc aaccgactac actcatttca
     8041 acactgacta atcaaactta tcatcaaaca aataatgtta attcacacac caaaaggacg
     8101 aacctgagcc ctaataattg tatccctaat tatatttatt ggctcaacca accttctagg
     8161 gcttcttccc catacattta cccctaccac tcagctatct atagacctaa gcatagccat
     8221 ccccctatga gcaggagccg taattctagg tttccgacac aaactaaaaa attctttagc
     8281 ccacttctca ccgcaaggaa cccccatctc actaattccc atactaatca tcatcgaaac
     8341 tatcagccta tttattcaac cgatagcact agcagtacga ctaacagcaa acattacagc
     8401 aggccatcta ttaatgcatc taatcggagg agctacccta gtacttatag acatcagccc
     8461 accaaccgct acaattacat ttattattct acttctactt acagtacttg aatttgccgt
     8521 agccttaatt caagcctatg tattcaccct tctagtcagc ctgtacctac atgataacac
     8581 ataatgaccc accaaaccca tgcataccat atagtaaacc caagcccatg accactaaca
     8641 ggagccctat cagctcttct actcacatcc ggcttagtaa tatgattcca ttacaactcc
     8701 acaattctcc tatcattagg cctcctgaca aacatcctaa ctatatatca atgatgacga
     8761 gatatcatcc gtgaaggaac ataccaaggc caccacaccc ctattgtaca aaaaggcctc
     8821 cgatacggaa taatcctgtt tattgtctcc gaagtattct tctttgccgg atttttctga
     8881 gcattttatc attccagcct agttcctacc cacgacctag gcggttgctg acccccaaca
     8941 ggaatcaccc ctttaaatcc cctagaagta ccccttctaa atacatcagt cctcttagca
     9001 tcaggagtct caattacatg agcccatcac agcctaatag aaggcaaccg aaaccatata
     9061 aaccaagccc tactaatcac cattctctta ggattatatt tcactatctt acaagcctca
     9121 gagtatttcg aaacatcatt ttctatctca gacggaattt acggctcaac attcttcata
     9181 gcaacgggat ttcatggcct ccacgtaatt attggctcaa ctttcctaat tgtctgtcta
     9241 ctacgacaac taaaattcca cttcacatca aaacatcatt tcggatttga agccgcagca
     9301 tgatactgac acttcgtaga tgtagtttga ctattcctat acgtttctat ctattgatga
     9361 ggatcctact cccttagtat aaacaataca actgacttcc aatcagttaa ttctgaaaaa
     9421 actcagaaga gagtaattaa cctacccatt atcatcacaa ttaacatcac cttatccttt
     9481 atcctcattt caattgcatt ctgattgcct caaataaact tatactccga aaaagcaaac
     9541 ccatatgaat gtggcttcga cccaacaagt tctgcacgcc ttcctttttc aataaaattt
     9601 ttcttagtag ccattacatt tctactattc gacctagaaa tcgccttact acttcccctc
     9661 ccatgagcga ttcaaacaac caataccact acaataatag caactgcctt tattttagtc
     9721 actattttgt ctcttggcct agcctacgaa tgaacacaaa aaggactaga atgaacagaa
     9781 taattggtaa ttagtttaaa taaaattaat gatttcgact cattagatta tgataataat
     9841 cataattacc aacaatgaca tctgctttcc taaatttaac tatagccttt acattatctc
     9901 tactaggtac ttttatattt cgctcccacc taatatccac tctcctctgc ctagaaggaa
     9961 taatactatc actatttgtc ataacttcaa catccacatt aaactccaac tccataatct
    10021 ccataaccat cccaattacc attctagttt ttgcagcctg cgaagcagca gtaggtttag
    10081 ccttactagt aaaaatttca aatacttacg gaacagacta cgtacaaaac ctcaaccttc
    10141 tacaatgtta aaaattattt tcccatctat catactcctc ccactaacat gactctcagc
    10201 caacaaaaaa atctgaacca atgtcacctc ctacagcttt ctagtgagcc tattaagctt
    10261 atcactccta tgacaaaatg acgaaaatta cctaaatttc tcagttatat tctcctccga
    10321 tccattatcc accccactaa tcattctaac aacttgactc ctcccactaa taatgctcgc
    10381 tagccaaaat cacataaaaa aagaaaatat aatgcatcaa aaactttaca tctcaatact
    10441 tattagcctc caaattttac tcatcataac attctccgca acagaactaa ttttatttta
    10501 tatcctgttc gaggccactc taatcccaac actaattatc attacacgat gaggcaacca
    10561 aacagaacgc ttaaatgcag gaatttattt cctgttttat acactaattg gctccatccc
    10621 actcttaatt gccctcattt caatccaaaa ctcaatagga acactcaact tcctaatcct
    10681 ttccctcaca acacaccccc taccctcaac atgatccaac accattctat gactagcatg
    10741 tataatagca tttataatca aaataccatt atacggagtc catctatgat taccaaaagc
    10801 ccacgtagaa gctccaattg caggctctat aattttagca gcaattctcc taaagctagg
    10861 gggttatggg ataatacgag tttccatcat tctagacccc ctaacaaaat ctttagccta
    10921 cccattcatc atcctctcat tatgaggcat aattataact agctcaatct gcctacgcca
    10981 aacagatcta aaatcattaa ttgcttactc atcagtaagc catatagccc tagtcatcac
    11041 agccattata atccagacac catgaagctt catgggagcc acaatactaa taatcgccca
    11101 cggcttaacc tcatcactct tattctgcct agcaaacacc aactacgaac gaattcacag
    11161 ccgaactata attatagctc gaggattaca aataatcttt ccattgatag caacatgatg
    11221 actattagca agcttagcca acctagcact accaccccta attaacctca taggcgagtt
    11281 attcattgtt atagcaacat tttcctgatc gaacccctct atcatcctta tagcaactaa
    11341 cattgtcatc acaggaatat actcaatata tatgattatc acaacccaac gaggaaaact
    11401 aaccagccac ataaacaacc tccaaccttc ccacacacga gaattaacac tcatagctct
    11461 acacattatt cccctcatac tattaacaat caaccctaaa ctcatcacag gcctaacaat
    11521 atgtagatat agtttacaaa aaacattaga ctgtgaatct aacaacagga aatcaaattc
    11581 cttatttacc aagaaagtat gcaagaactg ctaattcatg cacccatacc taaaacatat
    11641 ggctttctta cttttatagg atagaagtaa tccattggtc ttaggaacca aaaaccttgg
    11701 tgcaactcca aataaaagta ataaatataa taacaatcct aatcctcata attcttgatt
    11761 tacttacaac accaatcaca ttttcaataa caatcttaac caaacttatg tacttccgtc
    11821 atatgctcat tacatcaatt aaattctcat tcctccttag cctcttacct ttactactat
    11881 tcttccacca caacacagaa tacataatta ctaactgaca ttgactaact attaattcta
    11941 ttaaacttac tataagtttc aaaattgact atttctcaat cctattccta tcagtatccc
    12001 tattcgtaac atgatcaatt atacaattct cttcatgata tatacactct gacccccaca
    12061 ttaaccgatt cattaagtac ttaataatat tcctgaataa catactaatc ctaacctcag
    12121 ctaacaatct attccaactc tttattggat gagaaggggt aggaattata tccttcttat
    12181 taatcggatg atgatatggc cttgcagacg ccaacacagc ggccctccaa gcaatcctct
    12241 acaaccgagt cggagacatt ggtttcatcc tagctataac ctgattctgc ctaaacataa
    12301 actcctgaga actccaacaa attttcttaa ccaacaccaa caacaatcta gtccctctca
    12361 caggactact aattgcagcc acaggaaaat ccgcccaatt cggacttcat ccatgactcc
    12421 catcagctat agaaggccca actcccgtct ctgccctact acactcaagc acaatagttg
    12481 tagcagggat cttcctaata atccgattcc accccctaac ctcaaacaat agtactatta
    12541 taacagccat actatgtctt ggtgcaatca ccacattatt cacagcaatc tgtgctctca
    12601 cccaaaacga catcaaaaaa atcgtagctt tctcaacatc cagccaacta ggccttataa
    12661 tagtcacatt agggattaac caaccctacc ttgctttcct ccacatttgc acccatgcat
    12721 tcttcaaagc catattattc atatgctccg gatcaatcat ccatatcctc aacgatgaac
    12781 aagacattcg aaaaataggc aatataataa aagcaatacc attcacatca tcttgtctca
    12841 ttatcggaag cctagccctt accggaatac ctttcctcac aggattctat tcaaaagatc
    12901 tcatcatcga agccatcaac acgtgtaaca ccaacgcctg agccctaata atcactttaa
    12961 tcgccacatc cataactgct gtgtacagca tacggatcat ctacttcgtc accatgacaa
    13021 aaccacgata ctccccacta attactatta atgaaaacaa cccaaacctc attaatccaa
    13081 tcaaacgcct agcattagga agcatcctag caggcttcct tatctcacta aatattcctc
    13141 caactaacat tcaaattctc acaataccct gacatttaaa aataacagcc ctacttatta
    13201 caatcctagg atttgccatt gccctagaac ttaacaattt aacactaaat ctatcaataa
    13261 gcaaacccac caaactatca tcattctcaa cctccctagg ctactaccca ccaattatac
    13321 cccgaattat tcctcaaaaa actctaaatt ctagctacaa attatcctta aacctactag
    13381 acctaatctg atcagaaaag acaatcccaa aatcaacctc aatcacccaa acccaactat
    13441 ctaaaataat atccaaccaa aaaggactaa tcaaactata tttcctatca tttctcatca
    13501 ctatttcact aatttttatc ttacacacac ttaatcccga gtgatttcaa taataataaa
    13561 aatccccgca aacaatgacc acccagccac cactatcatt caagtagcac aactataaat
    13621 agccgcaacc ccaatccccc cctccaacat aaccccaaca tcatcaatct catacattaa
    13681 tcaatcgcct agactatcaa aatcaactaa ctccacctta ttattcaaac taaacaagta
    13741 gaacactacc aactccataa aaagccctaa aacaaaaaaa ctaaaaataa accaattaga
    13801 ccctcaagtt tccggatatt cctcagtagc catagcagtt gtatacccaa atacaaccaa
    13861 catcccaccc aaataaatta aaaatactat taaacctaaa aacgaacccc caaaccctaa
    13921 aactattaag cacccaatac atccactaac aatcaatcca aacccaccat aaataggtga
    13981 aggcttcaac gccaacccta gacaaccagt caaaaacagt aaacttaaaa taaacatata
    14041 atttgtcatt atttctacac agcatttaac tgtgactaat gacatgaaaa atcatcgttg
    14101 taattcaact atagaaacat ctaatgacaa acatccgaaa atctcacccc ctattcaaaa
    14161 tcatcaacca ctcctttatc gacctaccgg ccccatctaa catctcatca tgatgaaact
    14221 tcggttctct actaggagta tgcctcatag tacaaatcct cacaggctta ttcctagcaa
    14281 tacactacac gtctgatacc ataacagcat tctcatcagt cacccacatc tgccgagacg
    14341 taaactacgg ctgactaatc cgatacctac aagccaacgg cgcctcaata tttttcatct
    14401 gcctattcct ccatgtggga cgaggactat actatggatc ctacactttc ctagaaacct
    14461 gaaacattgg gatcatccta ctatttgcag tcatagcaac tgcattcatg ggctatgtac
    14521 tcccatgagg acaaatatca ttctgaggag ctacagtaat tacaaaccta ttatcagcta
    14581 tcccttacat tgggactacc ctagtcgaat gaatctgagg aggcttctca gtagacaaag
    14641 caaccctaac acgcttcttc gcattccact tcatcctccc attcattatc gccgcccttg
    14701 caattgtaca tcttcttttc ctccacgaaa caggatcaaa taaccccaca ggattaaact
    14761 ccgacgcaga caaaatccca ttccatccat attatacaat taaagacctc ctaggtgtat
    14821 ttatattact attattccta ataaccctag tactattctt cccagaccta ctaggagacc
    14881 cagacaatta tacacccgct aaccccctca acaccccacc ccacatcaaa ccagaatgat
    14941 actttctctt tgcctacgct attctacgct ccattcccaa caaactagga ggggtcgtag
    15001 ccctaatctt atcaatccta atcttagcct tcctaccatt cctgcatacc tcaaaacaac
    15061 gcagcttaac attccgccca atcacccaaa tcctttactg aatcctagta gccaacctcc
    15121 tagtcttaac atgaatcgga ggccaaccag tagaacaccc atttatcatt attggtcaac
    15181 tagcctccat cagttatttt tcaattatcc tcattctcat accaatctct ggaattgttg
    15241 aagacaaaat gttaaaatga aattaatgtc ccgatagtat aaaaattact ctggtcttgt
    15301 aaaccaaaaa tgaagagtca gtcttctcag gacaatcaag aagaaggaac tacctcccca
    15361 ccatcaacac ccaaagctga tattctactt aaactacttc ttgtcagtac ataaaatgat
    15421 atggacatta aaacatttat gtatatcgta cattaaatta ttttccccaa gcatataagc
    15481 atgtaatata tatctaatga tttaggacat acatttaaac tcaactataa attcacaaca
    15541 acatgtctat tctcaaatac attaagataa tgcttattag acatatctgt gttattagac
    15601 atgcaccatt aagtcataaa cctttctctt ccatatgact atccctgtcc ccaattggtc
    15661 tctatttcta ccatcctccg tgaaatcaac aacccgccca ctcgtccccc tcttctcgct
    15721 ccgggcccat tcgtcctggg ggtgactata ctgaaacttt accaggcatc tggttcttac
    15781 ttcagggcca tcaattggtt catcgtccat acgttcccct taaataagac atctcgatgg
    15841 taacgggtct aatcagccca tgatcaacat aactgtggtg atatacattt ggtatttttt
    15901 aattttcgga tgccttcctc aacatagccg tcaaggcatg aaggtcagca caaagtcctg
    15961 tggaaccttt tagttaaggg tcatttatcc tcatagacaa agctcgaaag actattttat
    16021 tcatgtttgt aagacataaa tatttataaa tactgaaaaa tctgtcaaca aaccccccca
    16081 ccccctacac ctgaaacttc aatgccaaac cccaaaaaca ttaaagcaag aattaaataa
    16141 aacaaaaagc tacttaattc ttaaaaggct tctccattct agtagaccac aaaattttaa
    16201 cttaaatctt agcattggta aaatttcccg acacaaaatc tttcctccta actaaaccct
    16261 ctttacttgc ctaccctcag aaaattccac atacaccaaa
//



spacer
spacer