Dbfetch

LOCUS       NM_171478               5333 bp    mRNA    linear   INV 05-SEP-2019
DEFINITION  Caenorhabditis elegans Uncharacterized protein (mec-1), mRNA.
ACCESSION   NM_171478
VERSION     NM_171478.6
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5333)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5333)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5333)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5333)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Sep 4, 2019 this sequence version replaced NM_171478.5.
FEATURES             Location/Qualifiers
     source          1..5333
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            1..5333
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /db_xref="GeneID:188259"
                     /db_xref="WormBase:WBGene00003165"
     CDS             54..5111
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /standard_name="T07H8.4b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_741560.3"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003165"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4b"
                     /db_xref="GeneID:188259"
                     /db_xref="GOA:Q5ZR41"
                     /db_xref="InterPro:IPR000152"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR001881"
                     /db_xref="InterPro:IPR002223"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR018097"
                     /db_xref="InterPro:IPR020901"
                     /db_xref="InterPro:IPR036880"
                     /db_xref="UniProtKB/TrEMBL:Q5ZR41"
                     /db_xref="WormBase:WBGene00003165"
                     /translation="MHLFLLFIPHVIAVKDLAWYSANPVLSSSHPVGPAAIQAATAID
                     FCQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRCVKQPNK
                     PEVQELKHRRTVTSTTSTPFQTVNEESTVEPSATKRLPVTLPVKKLELVQVRIFNKTE
                     SGHGNGLCQDCDPLYGTCLDGKCGCMKGFRSLGKVCIDLNECDNGAVCGPNARCVNEI
                     GSFQCVCDAGFSTDGDCKIGQEACMDEFDVNLTEEDCNNGKQEIKYYYDADSVQCKQF
                     FYGGCKTTSRNFFADLQTCDVICVSNQRDYLKSKGQSLSHHPVLEISSDLNNGNDLKS
                     NHYKIDLFSSPSSPVTPNRPLSADDWPLKPITLKPALNLDFSQGKTKSTAEKHKEADD
                     AEILVHQLTPEHNSCDLKFEPVLREECISADWAEKFFWNSEFKDCEPFWYDSSCDPRD
                     RAGKNFFETFEDCKNKCDGVQSQYVVPITTVPDEQSKIEEVETSETPGIVDETTTTAA
                     PEEESEENGFFFKVKPQNYLEDVLSSETEETQHYGFNPNEFLKQNSQNQKPTEITEIL
                     RILPAQTEHDEASELKKEDKIEHDILEHLKNKEPTEKVLSTPSTCDLEYDDALRNECT
                     SADWTELYYWNAQFKECEAFWYDSSCGDQDFSKKNLFKNFDDCNNQCVKKIGEALKKM
                     DPETTTTTSTTTTTTTAPTTTKMEEPKRSNYKQSDPLNLILNKALNPDESSELPEKFP
                     PAHEQGFVNFAIKSEVTATTKFDRLKYMAEFRKKLLALPDNFSTTPKQSSPTSSPTTT
                     RMRSPSTHKSTVSQATKTASSTPQSPSTTTSFDDFVEKEKKTVLETIKILDRPEDLCD
                     EPLHPKLEEDCKNDQWEIQWFFNSDRGACKSFWYGGCEIESRNFFPDHANCRHSCAHK
                     YATPASFSSKVYIPPGELSTPVPPRKDRLTTSLKLTYPHSEDLFPSEEHSTVVELDGN
                     FQRTEKQERIRLFPTKTFRPRAPTPTASNIVNVSEGEKTETAPAFYSHIDRVVHDMKT
                     GEHPGYTKPEEFVRRIESASNDYIKYDLQKPDVVTIIDKSPPTVPSRKERTERTEVTT
                     KLPSTRSINDPCDDEYDPKWDEDCLGDTWVVRSYYDSKAEKCKAFWYGGCHTSSRNIW
                     FDKETCRTSCAHKFPTDMPMYGGAQSSEVSAEILPSPQEENSSKETSSSSSSSSSSNT
                     AHISPEHRFKVDLDQKFADVKREHEGREDLAYSQMVQHPVTVSADCLEVYNASLSKPC
                     GDGKSWSNRYFYDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAGKSCL
                     DKFDERYLEDCRHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDLCESP
                     PRELTQACLQPFDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIFSTLE
                     ACQWICERKRDERKPAICADKFDTKYTESCGDSQWTEKWYFDQSSGDCSSFWWDECTS
                     SSQNIFPDEKSCTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYYDRAS
                     RTCRPFAYSGCGGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLP
                     QAGFRFYYDRNYGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTRASSE
                     GRPKFGIRKIRAKVQQL"
ORIGIN      
        1 atacatcaaa ttgtccatct aatggaagtt tactagatta actaaatcaa atgatgcact
       61 tgtttctttt attcatacca catgttatag ccgttaagga tcttgcttgg tattctgcaa
      121 atccggtgct gagctcatca catccagtag gcccagctgc tatacaagca gcgacagcca
      181 tcgacttctg tcagctacca gtcgacactg gaaagtgttc tcaacaactt gtgcgctatt
      241 attatgacgc ggcagtcgat gaatgcaagc gattcacttt ttcaggttgt ggaggtaatt
      301 caaataggtt tatgagaagg gcgcattgtc ggaacagatg tgtgaagcag cccaataaac
      361 ctgaggttca agaactgaaa catagaagga cagtgacttc gacgacatcg acaccatttc
      421 aaacagttaa cgaggaaagt acagttgaac cgtcagcaac aaaacgattg cctgtgacgt
      481 tacctgtgaa aaaattggaa cttgttcagg tacggatttt caacaagact gaatcgggtc
      541 atggaaatgg tttgtgccaa gattgcgatc cactctatgg aacttgctta gacggaaaat
      601 gtggatgtat gaaaggcttc cgatctcttg gaaaagtctg tattgatctc aatgaatgtg
      661 ataatggagc ggtttgtggt ccgaatgccc gatgcgtgaa cgaaattggg tcatttcaat
      721 gtgtttgtga cgctgggttt agtaccgatg gggattgtaa aatcgggcaa gaggcatgta
      781 tggatgaatt tgatgtgaat ttaactgaag aagattgcaa caatgggaaa caggaaatca
      841 aatattacta tgatgctgat agtgttcaat gcaaacaatt tttctatggt ggatgcaaga
      901 caacttcgag aaattttttt gcggatttac agacttgtga tgttatttgt gtgtccaatc
      961 aaagagacta tttaaagtca aaaggtcaat ctctctcgca ccatccagtt ctcgaaattt
     1021 catctgatct caataatgga aacgatttga aaagtaatca ttacaaaatt gatttattct
     1081 cgtcaccttc gtcaccagtg acaccaaacc gcccgttatc agctgatgac tggccgctga
     1141 aaccgattac attgaagcca gcactgaatc ttgacttttc acaaggaaag acaaaatcaa
     1201 cagctgaaaa acacaaagaa gcagatgatg cggaaatctt ggtacatcag ttgacaccag
     1261 aacataattc ttgtgacctc aaatttgagc ccgtccttcg agaagagtgc atttcagccg
     1321 attgggcaga aaagtttttc tggaactcag agtttaagga ttgtgagcca ttctggtatg
     1381 actcttcatg cgatccacgt gaccgagctg ggaagaactt tttcgaaact tttgaagatt
     1441 gcaaaaataa atgtgatggc gtccaatctc aatatgtggt accaattaca actgttcccg
     1501 atgaacaaag caaaattgag gaagttgaaa catcagaaac acctggaatt gttgatgaga
     1561 ctacaactac agcagccccg gaagaggaaa gcgaggagaa cggatttttc ttcaaagtaa
     1621 aaccacaaaa ctatctggaa gatgttttga gttccgagac agaggaaact caacattatg
     1681 ggttcaatcc caacgagttt ttgaaacaaa attctcaaaa tcagaaacct accgagatta
     1741 ctgagatact gagaattctt cccgctcaaa ctgaacacga cgaggcttct gagttgaaga
     1801 aagaagataa aattgagcac gatattttgg aacatcttaa aaataaagag cccactgaaa
     1861 aagtgttatc aactccgtca acttgtgatt tggaatatga cgatgccttg agaaatgaat
     1921 gcacttcggc agactggacc gagttgtact attggaatgc acagttcaag gaatgcgaag
     1981 cattttggta cgattcctct tgtggagatc aagattttag caaaaaaaat ttgttcaaga
     2041 atttcgatga ttgtaataat caatgtgtga agaaaattgg agaagcttta aaaaaaatgg
     2101 atcctgaaac aactacaaca acatccacta ctacaactac tactactgca cctaccacaa
     2161 caaaaatgga agaacctaaa cgttccaact acaagcaaag tgatccatta aacttaattt
     2221 tgaataaagc tctaaatccg gatgagtcct cagaattacc agagaagttt ccgccagctc
     2281 acgagcaagg cttcgttaac ttcgcaataa aatcagaagt cacagctact actaaattcg
     2341 acagattgaa atacatggct gagttcagaa agaaattact ggcacttcct gataattttt
     2401 ctacaactcc aaaacaatct tctcctactt cttctcctac cacaactcgt atgcgcagtc
     2461 cttccactca caagtcaact gtctcacaag ctacaaagac tgcatcttcc acgccgcaaa
     2521 gtccttcgac cactacaagc tttgatgact ttgttgagaa agagaagaaa actgttctag
     2581 agactataaa gattctagat cgcccagagg atctttgcga cgagcccctt catccaaagc
     2641 ttgaggaaga ttgcaaaaat gatcagtggg aaattcagtg gtttttcaat tctgatcgag
     2701 gtgcttgcaa gtcgttttgg tacggaggtt gcgagattga gagtagaaac ttctttcctg
     2761 atcatgcgaa ctgtcgacat tcctgtgctc acaagtatgc tacacctgca agtttctcat
     2821 cgaaagttta cattccgccc ggcgagttga gcactcctgt tcctccccgt aaagatcgtc
     2881 ttaccactag cctgaagctt acttaccctc actccgaaga tttgtttcct tcagaagaac
     2941 actcaacagt agttgaacta gacgggaatt tccagcgtac agaaaaacag gaacgcatac
     3001 gcctttttcc aacaaaaaca tttagaccaa gagcccctac gccaactgct tcaaatattg
     3061 tcaatgtttc tgaaggagaa aaaactgaaa cggctccagc cttctacagc catattgatc
     3121 gagtcgtcca cgacatgaaa acaggagaac acccgggata tacaaaacca gaagagtttg
     3181 taagaagaat tgaatctgcg agcaatgact atatcaaata tgacttgcaa aaaccagacg
     3241 tagttactat tatcgacaaa tctccaccta cggtaccatc aagaaaagaa agaactgaaa
     3301 gaacagaagt aaccacaaaa ttaccatcga ctcgatcaat aaatgatcca tgcgatgacg
     3361 agtatgatcc gaaatgggat gaagactgtc taggggacac ttgggttgtc agaagctatt
     3421 acgattcgaa ggctgaaaaa tgcaaagctt tttggtatgg aggatgccac actagtagca
     3481 gaaatatttg gtttgataag gagacatgtc gaacttcgtg tgctcacaaa ttccccaccg
     3541 acatgcccat gtatggaggt gcacaatctt cggaagtgtc tgccgaaatt ttgccgtctc
     3601 ctcaagaaga aaattcatcg aaagaaactt catcatcgtc ttcgtcttca tcttcttcta
     3661 acacggcaca catctcaccg gagcatcgat tcaaagtgga cctcgatcag aagtttgctg
     3721 atgttaaacg ggaacatgag ggcagagagg atttagcata ttcgcaaatg gttcagcatc
     3781 ctgttacagt ttcagctgat tgcttagaag tgtacaatgc aagtttgtca aaaccgtgtg
     3841 gagatggaaa atcttggagc aacagatatt tctacgacaa agacactcgc tcttgtcgca
     3901 tgttttggag caacggatgc ttcagctcat cgaaaaacaa ttttgatgac ttagaaactt
     3961 gccagtggaa gtgtgaagga agacatccac aacctgcagg aaaatcttgt ttggacaaat
     4021 ttgatgaacg atatctggag gactgtagac atggagaatt tacgaatcga ttttattttg
     4081 atcatgaccg gaagaagtgt gttgcattcc attggggagg ctgtcaatcg aaatcgcaaa
     4141 actttttcgc tgatatgaca gtttgccaag atctctgtga atctccaccg agagagttga
     4201 cacaagcttg tctgcaacca ttcgatacca cgtatgagac atcgtgctca gctgagaaac
     4261 ctcagcaata ttactatttt gacatgtctt ctggaatttg caaaatgttc tggtttggaa
     4321 attgcaaggg agagaatcaa aacatcttta gcaccttgga ggcttgccaa tggatctgtg
     4381 agagaaaacg tgacgaaagg aaaccagcaa tttgtgctga caagtttgac acaaagtaca
     4441 cggaatcttg cggagactct caatggactg agaaatggta tttcgatcaa tcatccggag
     4501 actgttcatc gttctggtgg gatgaatgca cttcctcgtc tcaaaatatt ttcccagatg
     4561 agaagtcgtg tacctcaaat tgcaaacatc ctggatttga aatttcgtca aagctggcta
     4621 cagaggaatc aaaattcaga tgccttgagc cggttgaaat cggatcttgc caagaaacat
     4681 atcctgcatt ttactacgac cgagcgtcac gtacgtgtcg tccatttgcc tattctggtt
     4741 gcggaggaaa ttcgaatcgt ttcatgacag tttctcagtg tgaaaacttg tgttttgcat
     4801 ttaattcgat gaatgaagcc gaagtagact gtcatcttcc catgcacatt ggttatggaa
     4861 agaatgagga cagttgcctg ccgcaagccg gattcagatt ctattatgat aggaattatg
     4921 gtaaatgttc ccagatgtgg tatctgggtt gtggtgggaa tgcgaacaat ttctactcgt
     4981 atgaaatctg ccagcgaaca tgctcacagt cagacgtgcc tcgggaactg gaacgaaaga
     5041 ctcgagcaag cagcgagggt aggccaaagt ttggaatccg caagattcgt gcaaaggttc
     5101 aacagctttg atgaaacatt tttttcaatt atttagttaa gatacccatt tgaatctctc
     5161 tctctcttcc tttctctcac ttctcgatct ttgataattt cccggttgtg tgtctgcttt
     5221 ccctttctgt ttttgtatgt ttgtcatttc agtttgatcc actttttaag ttctgagctt
     5281 ttactaacat ccgtactttg ccgttcgatc taataaagta tttgaaataa gaa
//