Dbfetch

LOCUS       NM_171477               6148 bp    mRNA    linear   INV 18-OCT-2019
DEFINITION  Caenorhabditis elegans Uncharacterized protein (mec-1), mRNA.
ACCESSION   NM_171477
VERSION     NM_171477.6
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 6148)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 6148)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 6148)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 6148)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Sep 4, 2019 this sequence version replaced NM_171477.5.
FEATURES             Location/Qualifiers
     source          1..6148
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            1..6148
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /db_xref="GeneID:188259"
                     /db_xref="WormBase:WBGene00003165"
     CDS             54..6077
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /standard_name="T07H8.4a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Uncharacterized protein"
                     /protein_id="NP_741559.3"
                     /db_xref="GeneID:188259"
                     /db_xref="GOA:Q5ZR42"
                     /db_xref="InterPro:IPR000152"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR001881"
                     /db_xref="InterPro:IPR002223"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR018097"
                     /db_xref="InterPro:IPR020901"
                     /db_xref="InterPro:IPR036880"
                     /db_xref="UniProtKB/TrEMBL:Q5ZR42"
                     /db_xref="WormBase:WBGene00003165"
                     /translation="MHLFLLFIPHVIAVKDLAWYSANPVLSSSHPVGPAAIQAATAID
                     FCQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRCVKQPNK
                     PEVQELKHRRTVTSTTSTPFQTVNEESTVEPSATKRLPVTLPVKKLELVQVRIFNKTE
                     SSFQSGHGNGLCQDCDPLYGTCLDGKCGCMKGFRSLGKVCIDLNECDNGAVCGPNARC
                     VNEIGSFQCVCDAGFSTDGDCKIGQEACMDEFDVNLTEEDCNNGKQEIKYYYDADSVQ
                     CKQFFYGGCKTTSRNFFADLQTCDVICVSNQRDYLKSKGQSLSHHPVLEISSDLNNGN
                     DLKSNHYKIDLFSSPSSPVTPNRPLSADDWPLKPITLKPALNLDFSQGKTKSTAEKHK
                     EADDAEILVHQLTPEHNSCDLKFEPVLREECISADWAEKFFWNSEFKDCEPFWYDSSC
                     DPRDRAGKNFFETFEDCKNKCDGVQSQYVVPITTVPDEQSKIEEVETSETPGIVDETT
                     TTAAPEEESEENGFFFKVKPQNYLEDVLSSETEETQHYGFNPNEFLKQNSQNQKPTEI
                     TEILRILPAQTEHDEASELKKEDKIEHDILEHLKNKEPTEKVLSTPSTCDLEYDDALR
                     NECTSADWTELYYWNAQFKECEAFWYDSSCGDQDFSKKNLFKNFDDCNNQCVKKIGEA
                     LKKMDPETTTTTSTTTTTTTAPTTTKMEEPKRSNYKQSDPLNLILNKALNPDESSELP
                     EKFPPAHEQGFVNFAIKSEVTATTKFDRLKYMAEFRKKLLALPDNFSTTPKQSSPTSS
                     PTTTRMRSPSTHKSTVSQATKTASSTPQSPSTTTSFDDFVEKEKKTVLETIKILDRPE
                     DLCDEPLHPKLEEDCKNDQWEIQWFFNSDRGACKSFWYGGCEIESRNFFPDHANCRHS
                     CAHKYATPASFSSKVYIPPGELSTPVPPRKDRLTTSLKLTYPHSEDLFPSEEHSTVVE
                     LDGNFQRTEKQERIRLFPTKTFRPRAPTPTASNIVNVSEGEKTETAPAFYSHIDRVVH
                     DMKTGEHPGYTKPEEFVRRIESASNDYIKYDLQKPDVVTIIDKSPPTVPSRKERTERT
                     EVTTKLPSTRSINDPCDDEYDPKWDEDCLGDTWVVRSYYDSKAEKCKAFWYGGCHTSS
                     RNIWFDKETCRTSCAHKFPTDMPMYGGAQSSEVSAEILPSPQEENSSKETSSSSSSSS
                     SSNTAHISPEHRFKVDLDQKFADVKREHEGREDLAYSQMVQHPVTVSADCLEVYNASL
                     SKPCGDGKSWSNRYFYDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAG
                     KSCLDKFDERYLEDCRHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDL
                     CESPPRELTQACLQPFDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIF
                     STLEACQWICERKRDERKPAICADKFDTKYTESCGDSQWTEKWYFDQSSGDCSSFWWD
                     ECTSSSQNIFPDEKSCTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYY
                     DRASRTCRPFAYSGCGGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNED
                     SCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTR
                     ASSEVCFEPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRFATQDICEN
                     TCNGLMNSNDPRICSFSPDWGSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRFDTFE
                     ICQKACEVTGTDPCMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNFLTK
                     EECQTKCEKRFPRAAPSKKKAKVKLPVGYSGAKPKDKTPMLRHINLNGNNQTYFKSEP
                     QWMDYSSCYGYRYNVTGRDTILNVHYCAIRGSADCISESYRSTEGEEYCNILRPFLRG
                     QNLYSFYFGLDSVNPMYRPKDGLSGRIQRKNETIAAVLVLKANQCHEIC"
ORIGIN      
        1 atacatcaaa ttgtccatct aatggaagtt tactagatta actaaatcaa atgatgcact
       61 tgtttctttt attcatacca catgttatag ccgttaagga tcttgcttgg tattctgcaa
      121 atccggtgct gagctcatca catccagtag gcccagctgc tatacaagca gcgacagcca
      181 tcgacttctg tcagctacca gtcgacactg gaaagtgttc tcaacaactt gtgcgctatt
      241 attatgacgc ggcagtcgat gaatgcaagc gattcacttt ttcaggttgt ggaggtaatt
      301 caaataggtt tatgagaagg gcgcattgtc ggaacagatg tgtgaagcag cccaataaac
      361 ctgaggttca agaactgaaa catagaagga cagtgacttc gacgacatcg acaccatttc
      421 aaacagttaa cgaggaaagt acagttgaac cgtcagcaac aaaacgattg cctgtgacgt
      481 tacctgtgaa aaaattggaa cttgttcagg tacggatttt caacaagact gaatcaagtt
      541 ttcagtcggg tcatggaaat ggtttgtgcc aagattgcga tccactctat ggaacttgct
      601 tagacggaaa atgtggatgt atgaaaggct tccgatctct tggaaaagtc tgtattgatc
      661 tcaatgaatg tgataatgga gcggtttgtg gtccgaatgc ccgatgcgtg aacgaaattg
      721 ggtcatttca atgtgtttgt gacgctgggt ttagtaccga tggggattgt aaaatcgggc
      781 aagaggcatg tatggatgaa tttgatgtga atttaactga agaagattgc aacaatggga
      841 aacaggaaat caaatattac tatgatgctg atagtgttca atgcaaacaa tttttctatg
      901 gtggatgcaa gacaacttcg agaaattttt ttgcggattt acagacttgt gatgttattt
      961 gtgtgtccaa tcaaagagac tatttaaagt caaaaggtca atctctctcg caccatccag
     1021 ttctcgaaat ttcatctgat ctcaataatg gaaacgattt gaaaagtaat cattacaaaa
     1081 ttgatttatt ctcgtcacct tcgtcaccag tgacaccaaa ccgcccgtta tcagctgatg
     1141 actggccgct gaaaccgatt acattgaagc cagcactgaa tcttgacttt tcacaaggaa
     1201 agacaaaatc aacagctgaa aaacacaaag aagcagatga tgcggaaatc ttggtacatc
     1261 agttgacacc agaacataat tcttgtgacc tcaaatttga gcccgtcctt cgagaagagt
     1321 gcatttcagc cgattgggca gaaaagtttt tctggaactc agagtttaag gattgtgagc
     1381 cattctggta tgactcttca tgcgatccac gtgaccgagc tgggaagaac tttttcgaaa
     1441 cttttgaaga ttgcaaaaat aaatgtgatg gcgtccaatc tcaatatgtg gtaccaatta
     1501 caactgttcc cgatgaacaa agcaaaattg aggaagttga aacatcagaa acacctggaa
     1561 ttgttgatga gactacaact acagcagccc cggaagagga aagcgaggag aacggatttt
     1621 tcttcaaagt aaaaccacaa aactatctgg aagatgtttt gagttccgag acagaggaaa
     1681 ctcaacatta tgggttcaat cccaacgagt ttttgaaaca aaattctcaa aatcagaaac
     1741 ctaccgagat tactgagata ctgagaattc ttcccgctca aactgaacac gacgaggctt
     1801 ctgagttgaa gaaagaagat aaaattgagc acgatatttt ggaacatctt aaaaataaag
     1861 agcccactga aaaagtgtta tcaactccgt caacttgtga tttggaatat gacgatgcct
     1921 tgagaaatga atgcacttcg gcagactgga ccgagttgta ctattggaat gcacagttca
     1981 aggaatgcga agcattttgg tacgattcct cttgtggaga tcaagatttt agcaaaaaaa
     2041 atttgttcaa gaatttcgat gattgtaata atcaatgtgt gaagaaaatt ggagaagctt
     2101 taaaaaaaat ggatcctgaa acaactacaa caacatccac tactacaact actactactg
     2161 cacctaccac aacaaaaatg gaagaaccta aacgttccaa ctacaagcaa agtgatccat
     2221 taaacttaat tttgaataaa gctctaaatc cggatgagtc ctcagaatta ccagagaagt
     2281 ttccgccagc tcacgagcaa ggcttcgtta acttcgcaat aaaatcagaa gtcacagcta
     2341 ctactaaatt cgacagattg aaatacatgg ctgagttcag aaagaaatta ctggcacttc
     2401 ctgataattt ttctacaact ccaaaacaat cttctcctac ttcttctcct accacaactc
     2461 gtatgcgcag tccttccact cacaagtcaa ctgtctcaca agctacaaag actgcatctt
     2521 ccacgccgca aagtccttcg accactacaa gctttgatga ctttgttgag aaagagaaga
     2581 aaactgttct agagactata aagattctag atcgcccaga ggatctttgc gacgagcccc
     2641 ttcatccaaa gcttgaggaa gattgcaaaa atgatcagtg ggaaattcag tggtttttca
     2701 attctgatcg aggtgcttgc aagtcgtttt ggtacggagg ttgcgagatt gagagtagaa
     2761 acttctttcc tgatcatgcg aactgtcgac attcctgtgc tcacaagtat gctacacctg
     2821 caagtttctc atcgaaagtt tacattccgc ccggcgagtt gagcactcct gttcctcccc
     2881 gtaaagatcg tcttaccact agcctgaagc ttacttaccc tcactccgaa gatttgtttc
     2941 cttcagaaga acactcaaca gtagttgaac tagacgggaa tttccagcgt acagaaaaac
     3001 aggaacgcat acgccttttt ccaacaaaaa catttagacc aagagcccct acgccaactg
     3061 cttcaaatat tgtcaatgtt tctgaaggag aaaaaactga aacggctcca gccttctaca
     3121 gccatattga tcgagtcgtc cacgacatga aaacaggaga acacccggga tatacaaaac
     3181 cagaagagtt tgtaagaaga attgaatctg cgagcaatga ctatatcaaa tatgacttgc
     3241 aaaaaccaga cgtagttact attatcgaca aatctccacc tacggtacca tcaagaaaag
     3301 aaagaactga aagaacagaa gtaaccacaa aattaccatc gactcgatca ataaatgatc
     3361 catgcgatga cgagtatgat ccgaaatggg atgaagactg tctaggggac acttgggttg
     3421 tcagaagcta ttacgattcg aaggctgaaa aatgcaaagc tttttggtat ggaggatgcc
     3481 acactagtag cagaaatatt tggtttgata aggagacatg tcgaacttcg tgtgctcaca
     3541 aattccccac cgacatgccc atgtatggag gtgcacaatc ttcggaagtg tctgccgaaa
     3601 ttttgccgtc tcctcaagaa gaaaattcat cgaaagaaac ttcatcatcg tcttcgtctt
     3661 catcttcttc taacacggca cacatctcac cggagcatcg attcaaagtg gacctcgatc
     3721 agaagtttgc tgatgttaaa cgggaacatg agggcagaga ggatttagca tattcgcaaa
     3781 tggttcagca tcctgttaca gtttcagctg attgcttaga agtgtacaat gcaagtttgt
     3841 caaaaccgtg tggagatgga aaatcttgga gcaacagata tttctacgac aaagacactc
     3901 gctcttgtcg catgttttgg agcaacggat gcttcagctc atcgaaaaac aattttgatg
     3961 acttagaaac ttgccagtgg aagtgtgaag gaagacatcc acaacctgca ggaaaatctt
     4021 gtttggacaa atttgatgaa cgatatctgg aggactgtag acatggagaa tttacgaatc
     4081 gattttattt tgatcatgac cggaagaagt gtgttgcatt ccattgggga ggctgtcaat
     4141 cgaaatcgca aaactttttc gctgatatga cagtttgcca agatctctgt gaatctccac
     4201 cgagagagtt gacacaagct tgtctgcaac cattcgatac cacgtatgag acatcgtgct
     4261 cagctgagaa acctcagcaa tattactatt ttgacatgtc ttctggaatt tgcaaaatgt
     4321 tctggtttgg aaattgcaag ggagagaatc aaaacatctt tagcaccttg gaggcttgcc
     4381 aatggatctg tgagagaaaa cgtgacgaaa ggaaaccagc aatttgtgct gacaagtttg
     4441 acacaaagta cacggaatct tgcggagact ctcaatggac tgagaaatgg tatttcgatc
     4501 aatcatccgg agactgttca tcgttctggt gggatgaatg cacttcctcg tctcaaaata
     4561 ttttcccaga tgagaagtcg tgtacctcaa attgcaaaca tcctggattt gaaatttcgt
     4621 caaagctggc tacagaggaa tcaaaattca gatgccttga gccggttgaa atcggatctt
     4681 gccaagaaac atatcctgca ttttactacg accgagcgtc acgtacgtgt cgtccatttg
     4741 cctattctgg ttgcggagga aattcgaatc gtttcatgac agtttctcag tgtgaaaact
     4801 tgtgttttgc atttaattcg atgaatgaag ccgaagtaga ctgtcatctt cccatgcaca
     4861 ttggttatgg aaagaatgag gacagttgcc tgccgcaagc cggattcaga ttctattatg
     4921 ataggaatta tggtaaatgt tcccagatgt ggtatctggg ttgtggtggg aatgcgaaca
     4981 atttctactc gtatgaaatc tgccagcgaa catgctcaca gtcagacgtg cctcgggaac
     5041 tggaacgaaa gactcgagca agcagcgagg tttgtttcga gcctccggga gatcgtggca
     5101 tttgcggtaa gaactcaagc accaatccac ttaaacgatg gacatatggt aatcagaaat
     5161 gtacatcatt tacttattct ggctgcggag gaaatcgaaa tagatttgca acacaggata
     5221 tatgtgaaaa tacatgtaat gggcttatga acagtaatga ccctcgtatt tgctcgttct
     5281 cgcccgattg gggttcttgt aatcagcttc gctatgtttg gttctacaat ttgacccgtg
     5341 gaacctgcga tcaatttctt tacggtggct gtggaggaaa tccaaatcgc ttcgacactt
     5401 ttgaaatttg tcaaaaagcg tgtgaagtca ctggaacaga tccgtgtatg gaatctttgg
     5461 atcgtggaag ttggtgtgag gcaatgtcaa atagatatta ttttaacaag agagcacgcc
     5521 aatgcaaagg atttcactac accgggtgtg gaaaaagtgg aaataatttt ttgacaaaag
     5581 aagagtgtca gacaaaatgt gagaaacgtt ttccgcgtgc agcgccgtca aaaaagaagg
     5641 cgaaggttaa actaccagtt ggatattccg gtgcaaagcc gaaagataaa acgccaatgc
     5701 tacggcacat caatttgaat ggaaataatc aaacatattt caaatccgag cctcaatgga
     5761 tggactattc ctcttgttat ggttacaggt acaatgtaac tggacgagac actattctga
     5821 atgttcatta ttgtgcaatt cgtggctctg cagactgcat cagtgaaagt tataggtcta
     5881 cggaggggga ggagtactgt aatatcttga gaccatttct acgaggccaa aacttatact
     5941 ctttctattt tggattagat tcagtgaatc caatgtaccg cccaaaggat gggctctccg
     6001 gaagaattca acggaaaaac gaaacgattg ctgccgttct tgtattgaaa gctaaccagt
     6061 gccatgaaat ttgctagcat ttttctaagt taattatttg aaattgtcat tcaaattcat
     6121 agaactcaat aaatttattt gttttaaa
//