Dbfetch

LOCUS       NM_073779                432 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans 60S ribosomal protein L28 (rpl-28), mRNA.
ACCESSION   NM_073779
VERSION     NM_073779.6
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 432)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 432)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 432)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 432)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Sep 4, 2019 this sequence version replaced NM_073779.5.
FEATURES             Location/Qualifiers
     source          1..432
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            1..432
                     /gene="rpl-28"
                     /locus_tag="CELE_R11D1.8"
                     /db_xref="GeneID:179739"
                     /db_xref="WormBase:WBGene00004442"
     CDS             6..386
                     /gene="rpl-28"
                     /locus_tag="CELE_R11D1.8"
                     /standard_name="R11D1.8"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="60S ribosomal protein L28"
                     /protein_id="NP_506180.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004442"
                     /db_xref="EnsemblGenomes-Tr:R11D1.8.1"
                     /db_xref="EnsemblGenomes-Tr:R11D1.8.2"
                     /db_xref="GeneID:179739"
                     /db_xref="WormBase:WBGene00004442"
                     /translation="MSDALVWQVIRNNSAFLRTQRGIGKRFSTEKFNLKKVNSPKYSG
                     LANKHAIDVSAAAKGVVVSTKNEKGRPAKAVTTSTLSKTPVASVRRLAKNAGFNKFNK
                     LAQRRAAAIVRSQVKKAKVQKTDA"
ORIGIN      
        1 gtaaaatgtc cgacgctctc gtgtggcaag tcatccgcaa caacagcgct ttcctcagaa
       61 cccagcgcgg aatcggaaag cgattctcca ctgagaagtt caacctcaag aaggtgaaca
      121 gcccaaaata cagtggactc gctaacaagc acgccatcga cgtcagcgcc gccgccaagg
      181 gagtcgttgt atctaccaag aacgagaagg gaagaccagc caaggccgtc accacctcca
      241 ccttgagcaa gaccccagtt gcttcagtcc gtcgcttggc caagaacgcc ggattcaaca
      301 agttcaacaa gctcgctcaa cgtcgtgccg ccgccatcgt ccgctcccaa gtgaagaagg
      361 ctaaggtcca aaagactgac gcataaatga cgtttgttac gttgttgtta tgaatataaa
      421 gtgttacagc tt
//