Dbfetch

LOCUS       NM_071609               1086 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Serpentine Receptor, class H (srh-213),
            mRNA.
ACCESSION   NM_071609
VERSION     NM_071609.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1086)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1086)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1086)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1086)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Sep 4, 2019 this sequence version replaced NM_071609.1.
FEATURES             Location/Qualifiers
     source          1..1086
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            1..1086
                     /gene="srh-213"
                     /locus_tag="CELE_T22F3.5"
                     /db_xref="GeneID:188749"
                     /db_xref="WormBase:WBGene00005423"
     CDS             64..1056
                     /gene="srh-213"
                     /locus_tag="CELE_T22F3.5"
                     /standard_name="T22F3.5"
                     /note="Product from WormBase gene class srh;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serpentine Receptor, class H"
                     /protein_id="NP_504010.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00005423"
                     /db_xref="EnsemblGenomes-Tr:T22F3.5"
                     /db_xref="GeneID:188749"
                     /db_xref="GOA:Q94302"
                     /db_xref="InterPro:IPR019422"
                     /db_xref="UniProtKB/TrEMBL:Q94302"
                     /db_xref="WormBase:WBGene00005423"
                     /translation="MPHDFCTSTFYLYTADFQRLFLHYFGFVAIPVHVYGAYCIIFHT
                     PSSMKSVKLSLLNFHFLSCFFDLGLSFLTTPYILFPALAGYPLGVLKDFGVRNEHQLY
                     FMLVVGAYMLVTIILVFENRLLILIPTSKCWRVFRTPWFITHFIVATVFFFPAYQMIP
                     DQQLAKNFVISIAPCIPLYVNADLVFVMLLETRFFLRAAGVLILAGFMEIWIFAYVTD
                     RLLGQQINRTMSKRTVELHKKFQKAFLTQLTIPILILILPIIYIGVSCLVFYHNQAIN
                     NITVIIVSSHGFFSTIVMIYIHAPYREFTLRWLTVLTHVRLENQSSVVPSNNIT"
ORIGIN      
        1 acataacagg tgtaaagttt gttcttttca accgaaaatc cctctcggtg ttcactttcc
       61 aaaatgccgc acgacttctg tactagcact ttctacctgt ataccgcaga ttttcaacgt
      121 ttatttctcc attattttgg ttttgtggcg atcccggtgc acgtctacgg tgcctattgt
      181 atcattttcc ataccccatc gtccatgaaa tccgtgaagc tgagcctctt gaattttcac
      241 tttttaagct gctttttcga tttgggcctc agttttttga cgacacctta catattgttc
      301 ccagcactag ctggttatcc attgggtgtg ttgaaggatt ttggagtgag gaatgagcat
      361 cagttgtatt ttatgcttgt tgttggagct tacatgctcg tcacaatcat tctcgtcttc
      421 gagaaccgtc tactcatcct catcccgacg agcaaatgtt ggcgtgtatt tcgaactccg
      481 tggttcatca cgcatttcat cgttgcaaca gtgttctttt tccccgcgta ccaaatgatc
      541 cccgaccagc aactcgcaaa gaactttgtg ataagcatag ccccatgcat tccactttat
      601 gtgaatgctg acctggtttt tgtgatgctc cttgaaactc gatttttcct ccgagcagct
      661 ggtgttctaa ttttggcggg gttcatggag atttggatat ttgcatatgt taccgataga
      721 ttgcttgggc aacagataaa tcggacaatg tcgaagagga cagtggagtt gcacaagaaa
      781 tttcaaaaag catttctgac ccagctaaca atcccaattc ttattctcat cctgcccatc
      841 atctatatcg gtgtttcgtg cctagtcttc taccacaatc aggcaatcaa taatattact
      901 gtgataattg tgtcatccca tggtttcttc tcgacaatcg tcatgattta catacacgca
      961 ccgtaccgcg agtttacgct tcgatggctc acggttttga cgcatgttcg attggaaaat
     1021 cagagttcgg tggtgccgag taataatatt acatagctgc tcaataaagt gtgcatttaa
     1081 tttgaa
//