Dbfetch

LOCUS       NM_065425                698 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Hemiasterlin resistant protein 1 (har-1),
            mRNA.
ACCESSION   NM_065425
VERSION     NM_065425.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 698)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 698)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 698)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 698)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Sep 4, 2019 this sequence version replaced NM_065425.3.
FEATURES             Location/Qualifiers
     source          1..698
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..698
                     /gene="har-1"
                     /locus_tag="CELE_C16C10.11"
                     /db_xref="GeneID:175529"
                     /db_xref="WormBase:WBGene00007630"
     CDS             4..468
                     /gene="har-1"
                     /locus_tag="CELE_C16C10.11"
                     /standard_name="C16C10.11"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Hemiasterlin resistant protein 1"
                     /protein_id="NP_497826.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007630"
                     /db_xref="EnsemblGenomes-Tr:C16C10.11.1"
                     /db_xref="EnsemblGenomes-Tr:C16C10.11.2"
                     /db_xref="GeneID:175529"
                     /db_xref="WormBase:WBGene00007630"
                     /translation="MVRRRTASPSPSAPVRSAPRPAAQSSFAAPPPRPAAAAPAYHPP
                     AAPTPMGAPMGAPSQGPGLMKQMAATAGGVAIGSAVGHAVGGMFTGGGSSHAEQAPAA
                     AAAPAGAPQASGYSQPCEFEWRQFVDCAQNQSDVSLCNGFNDIFKQCKARYA"
ORIGIN      
        1 aaaatggttc gtcggcgcac tgcttcccca tctccatcgg ccccagttcg atcggctcca
       61 cgtccagccg cccagtcatc cttcgccgct ccaccaccaa gaccagccgc cgctgctcca
      121 gcttatcatc caccagcagc tccaactcca atgggagccc caatgggtgc tccatctcag
      181 ggaccaggat tgatgaagca aatggctgca accgccggag gagtcgccat tggatccgct
      241 gttggtcacg ccgtcggagg aatgttcacc ggaggcggta gctctcatgc cgagcaagct
      301 ccagctgctg ctgctgctcc agccggtgct ccacaagctt ctggctactc gcagccatgc
      361 gaattcgagt ggagacaatt tgtggactgc gcacaaaacc aatctgatgt ttctctgtgc
      421 aacggattca atgatatttt caagcaatgc aaggccagat atgcctaatc acagttcccc
      481 cgtatagata ttgaattaag tgaaaacgtt tagcatttgg tggaaattga ttatttctct
      541 ctgaaaactc aaattctact ttatggttat cgctttcaat ttgacttttt tccttttttt
      601 tgtcgtattt agctccctga attccaaatg ttccgtagtt ttgttctttt tcaattttcc
      661 ccagttttct gttcgcaaat aaattgactc gttgtttt
//