Dbfetch

LOCUS       NM_061982               4371 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Protein patched homolog 3 (ptc-3), mRNA.
ACCESSION   NM_061982
VERSION     NM_061982.6
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4371)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4371)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4371)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4371)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Sep 4, 2019 this sequence version replaced NM_061982.5.
FEATURES             Location/Qualifiers
     source          1..4371
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            1..4371
                     /gene="ptc-3"
                     /locus_tag="CELE_Y110A2AL.8"
                     /db_xref="GeneID:173631"
                     /db_xref="WormBase:WBGene00004210"
     CDS             82..4167
                     /gene="ptc-3"
                     /locus_tag="CELE_Y110A2AL.8"
                     /standard_name="Y110A2AL.8b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Protein patched homolog 3"
                     /protein_id="NP_494383.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004210"
                     /db_xref="EnsemblGenomes-Tr:Y110A2AL.8b"
                     /db_xref="GeneID:173631"
                     /db_xref="GOA:H2L0G5"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/Swiss-Prot:H2L0G5"
                     /db_xref="WormBase:WBGene00004210"
                     /translation="MKVHSEQPPGKDEPGPIRRFLENRLIGNFDSEDFSDAWKKKFAH
                     APTWCDADMSLQQIKRGKAVGNTVALTARAFFQLWLFRIGCFVQRWAWSTIFISLFLY
                     CLCLGGLRHVTIETDLVKLWVSEGGRLNEEMGYLGQVKFERESGHLVHKVKRAVEQTT
                     EPPAPAVKAEVRRGPELPKENGLGGGFQVVIQTPSFDGQNILSKEALQQHTKLMEEIS
                     TYEVKMFNETWTLSDICFKPPGPSFNSGPLAGIMSKLLDKIIPCIWITPIDCYWDGAK
                     PLGPNPPLNLGPEVASFVSSLPPGNVTWKNLNPTSVIKEVGTLFDLGPIGNFFERAGI
                     DGAYLDRPCIDPLEEECPKSAPNYFDRCHALTKFNEWNMAKAMSEQVTLERKIIPKDD
                     GKSDIAETILNDIFGKKRRKRQADTTTKKPATKKDEDYYEYEDDADYLAGIANSTIAK
                     KNPEKEAKDLLCLEYGSSLLKWMQENPERLGEFLTKEEMPDYPNYGDVMTGGCKGFGK
                     KIMEWPEDLIIGGIQRDNGKLVSAEALQSVFLVSGAYDVFARIKNDKTDSHPGLDRHH
                     FQPWMAGEIISTWQRNFTKRLYSHELNRERRQFHPLASTSIADMLEEFSQFNYIIIVI
                     GYILMVIYAAFTQGRFQGWWLAVQSNVALAICGVILVTISSICGLGFATHLGINFNAA
                     TTQVVPFLSLGLGIDDMFLLLHNYDEIINICNKNEIGVLLKETGMSVMLTSINNILAF
                     ISGYVLPIPALRSFCSQTAILLAFNLIFLMFIFPAMIGIDLRRQRKGKRDLAYCSRGN
                     PQMATSQSVPSNVSNNTQMSSRAELAGYEKQADEYKRHEPWYTVGGFLNKIYIPALKN
                     NVVKACVLIGTTTAVVFGLYGMYTSTLGLELADVLPEHTPPAAFLRAREQYFSFYPMF
                     AVLRGDKLDIPNQQQLIEEYRAQLGSSKFMIKAEGKLQPYWMSMLRVWLQSLDMALEK
                     DLAAGKFDLTNGNPIKVNGEKPSPESMIAARLVCSFGTNYNCDGRLGKMKMVENEVIN
                     PEGFYNYLTGWFNVDNMMYYVSQASFYPTPPGWEYNEKLAKVVPAAEPLLYSQMPFYQ
                     NDLIDTPAIVKMIEEIRATCEEYSERGLSNHPSGIAFTFWEQYLTLRWNLFQAICIIA
                     LAVFCVISILMFNPWAATLIMCIVVITTIELGGFMGLMGIKMNPISAVTLICAVGIGV
                     EFTAHVELAFLTALGTIDQRLESCLQHMFVPVYHGAISTFLGVVMLVFSEFDFVVTYF
                     FYTMTLLVALGVFNGLCVLPVILTLVGPKPELTPTDGSSVLPPPPPLRQQYAEKSGGV
                     EGGMRKRKEKRPAEVEMSARDSPSTSSASHSSDDESSPAHK"
ORIGIN      
        1 aaatccacca tcactcaaac caaacaaaat actgcaaatt atctaaaaat cgggtgattg
       61 gaatccggta aaaatccccg aatgaaggtg cattcggaac aaccgcccgg gaaggacgaa
      121 cccggtccga tcagaaggtt tctggaaaac cgcctgatcg gaaatttcga ttccgaagat
      181 ttctcagatg cgtggaagaa aaaattcgcc cacgcgccga cttggtgtga tgcagacatg
      241 tctcttcagc agattaagcg gggtaaagcc gttggaaaca ccgttgcgct caccgccaga
      301 gcatttttcc aattatggtt gttcaggata ggatgttttg tgcaacgatg ggcttggtcc
      361 actattttta tcagtttatt cctctactgc ctctgcctcg gaggccttcg ccacgtcaca
      421 atcgaaaccg atctcgtgaa actttgggtg tcagaaggtg gacggctgaa tgaagaaatg
      481 ggatatctcg gccaagttaa atttgaacga gaatccggac acctagtgca taaagtgaaa
      541 agagccgtcg aacagactac ggagccgccg gcaccggcag tgaaggcaga agtccggcgt
      601 ggtcccgagc tgccaaagga aaacggattg ggaggaggtt ttcaggtggt aatccaaact
      661 ccgtccttcg atggtcagaa tattctctcc aaggaggctc tgcagcagca taccaagttg
      721 atggaggaaa tttctacgta tgaagtgaaa atgttcaatg aaacctggac cctctccgac
      781 atctgcttca agccgccagg cccatctttc aacagtggcc cgctggctgg aatcatgtcc
      841 aagctccttg acaagatcat tccatgcatc tggatcacac cgatcgattg ctattgggat
      901 ggtgcaaagc cactgggacc aaatcctccg ttgaacttgg gcccagaagt cgccagcttc
      961 gtgtcctccc tcccacctgg caacgttacc tggaagaact tgaatccaac atctgtcatc
     1021 aaagaggtcg gcaccctatt cgacttggga cccatcggca actttttcga aagagccggt
     1081 attgacggag cctacctcga caggccatgc attgacccac tggaggagga atgcccaaag
     1141 tctgctccga actacttcga taggtgtcat gcactgacaa agtttaacga gtggaatatg
     1201 gcaaaggcca tgagcgagca ggtcaccctg gagcgcaaaa taatcccaaa ggacgatgga
     1261 aagtcagaca tcgccgaaac gattctcaac gacatttttg gaaagaagag aaggaagcga
     1321 caagcggata ctacgaccaa gaagcctgcc acgaaaaaag acgaagacta ctacgagtac
     1381 gaagacgacg cggactacct agcaggaatc gccaactcca caatcgccaa gaagaatccg
     1441 gaaaaggaag ccaaggacct tctgtgcctt gagtacggaa gctcacttct caagtggatg
     1501 caggagaatc ccgagagact cggcgagttc ttgaccaagg aggagatgcc agattacccg
     1561 aactatggag atgtgatgac cggtggatgt aagggattcg gaaagaagat catggagtgg
     1621 ccggaggact tgatcattgg aggaatccag cgggacaatg ggaagttggt gtcagcagag
     1681 gccctgcaat ccgtgttcct ggtctcagga gcctatgacg tgtttgccag aatcaagaac
     1741 gacaaaaccg acagccaccc cggccttgac cgccaccact tccaaccatg gatggctgga
     1801 gagatcatca gcacgtggca gagaaacttc accaagcgac tctacagcca tgagctcaac
     1861 cgtgaacgcc gtcagttcca ccccctagct tccacctcaa tcgctgacat gctcgaggag
     1921 ttctcccagt tcaactacat catcatcgtc atcggataca tcttgatggt gatctacgcc
     1981 gcgtttaccc agggaaggtt ccaaggatgg tggctggctg tgcagtcaaa tgtggcattg
     2041 gcaatttgcg gagttatcct ggttactata tcatcgattt gtggattagg attcgctact
     2101 catcttggga tcaatttcaa tgcagcgaca actcaagttg tgccattcct ttccttaggt
     2161 ctaggaatcg atgatatgtt cctccttctg cataactacg atgaaatcat caatatttgc
     2221 aacaaaaacg agatcggagt attgctaaaa gagaccggaa tgtctgtgat gttgacctct
     2281 atcaacaaca ttctcgcctt catctcggga tacgttctcc cgatccctgc tctacgatcc
     2341 ttctgctccc aaaccgcgat tctccttgcc ttcaacttga tcttcctcat gttcatcttc
     2401 ccagcaatga tcggaatcga tctgagaaga cagcgaaaag gaaaaagaga tttggcctac
     2461 tgcagtcgag gaaacccaca aatggcgact agtcaaagtg tgccgagcaa tgtttcaaat
     2521 aacacgcaga tgtcatcacg tgccgagttg gctggctacg agaagcaggc cgacgagtat
     2581 aagcgtcacg agccgtggta caccgtcgga ggattcctca acaagatcta cattccggca
     2641 ctcaagaata atgttgttaa ggcttgcgtt ctcatcggaa ctaccaccgc cgtcgtcttc
     2701 ggactctacg gaatgtacac ctcgactctc ggtctcgagc tcgccgacgt gcttccagag
     2761 cacaccccac cagcggcctt ccttcgtgct cgcgagcaat acttctcctt ctacccgatg
     2821 tttgcagttc ttcgtggtga caagcttgac attccgaacc aacagcaact tatcgaagag
     2881 tacagagcac agttgggatc ttcaaagttt atgatcaagg ctgaaggtaa acttcaaccc
     2941 tactggatgt ctatgctcag agtctggctg caatctttgg acatggcctt ggaaaaagac
     3001 ctcgccgctg gcaaattcga tttgacaaat ggaaatccta tcaaggtgaa cggagagaag
     3061 ccaagtcccg aatcgatgat cgcggctaga cttgtatgct ccttcggcac caactacaac
     3121 tgtgacgggc ggctcggaaa gatgaagatg gtggaaaatg aggttattaa tccagaagga
     3181 ttctataact atctgacggg atggttcaac gttgacaaca tgatgtacta cgtgtcccag
     3241 gcttcattct atccaacacc acctggatgg gagtataatg agaagctcgc caaggtggtt
     3301 ccggctgccg agccattgtt gtactcacag atgccgtttt atcagaatga tttgatcgat
     3361 acaccagcga ttgtaaaaat gattgaggaa atccgtgcca cttgcgagga atactccgaa
     3421 cgaggccttt ccaaccatcc atcgggtatc gccttcacct tctgggagca atatcttact
     3481 ttgagatgga acttgttcca agccatctgc atcatcgcgc tcgccgtgtt ctgtgtcatt
     3541 tcaattctaa tgttcaatcc atgggcagcc actcttatca tgtgcatcgt agtgatcact
     3601 accatcgagc tgggaggatt catggggctt atgggcatca agatgaaccc gatttccgct
     3661 gtaaccctca tctgtgccgt cggaatcggt gtcgagttca ctgctcacgt cgagttggcc
     3721 ttcctgacag ctctaggaac catcgatcaa cgcctggagt cttgcctcca gcacatgttc
     3781 gtgccagtct atcacggagc catctcaacg ttcctcggag ttgtgatgct tgtgttctcc
     3841 gagttcgact tcgtcgtcac ctacttcttc tacacaatga cgttgctggt agcgttgggt
     3901 gtgttcaacg ggttgtgtgt tcttccagtg atccttacgc tggtcggccc gaagcctgag
     3961 ctgacaccaa ccgatggtag cagtgtgctt ccaccacctc caccattgcg gcagcagtac
     4021 gctgagaaga gtggaggtgt ggaaggtggg atgaggaaac ggaaggagaa gaggcctgcg
     4081 gaggtcgaaa tgtcggctcg cgactctcca tcaacatcct cagcgtccca ttcttctgat
     4141 gacgagtcat cgccagcgca caagtaataa aacaatacaa tgttatccca atttttcctt
     4201 ttttcttgcc aaacgggtca ccgttccccc caccaattgt ttttttttgt tttttgtccc
     4261 tttttcgaaa aagtttctcg gtagattttg acccaattct tgcatatctg tactatatgg
     4321 tttttgtttt caccacactt tttttctaaa attaaagaat tctaaaatct c
//