Dbfetch

LOCUS       NM_061545               1837 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans L-glutamate gamma-semialdehyde dehydrogenase
            (alh-6), mRNA.
ACCESSION   NM_061545
VERSION     NM_061545.7
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1837)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1837)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1837)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1837)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Sep 4, 2019 this sequence version replaced NM_061545.6.
FEATURES             Location/Qualifiers
     source          1..1837
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            1..1837
                     /gene="alh-6"
                     /locus_tag="CELE_F56D12.1"
                     /db_xref="GeneID:173510"
                     /db_xref="WormBase:WBGene00000112"
     CDS             4..1695
                     /gene="alh-6"
                     /locus_tag="CELE_F56D12.1"
                     /standard_name="F56D12.1a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="L-glutamate gamma-semialdehyde dehydrogenase"
                     /protein_id="NP_493946.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00000112"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1a.1"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1a.2"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1a.3"
                     /db_xref="GeneID:173510"
                     /db_xref="GOA:G5EC31"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:G5EC31"
                     /db_xref="WormBase:WBGene00000112"
                     /translation="MLSFAARRSLITQKCAASTYSGLTSADFLKKKTNEPILEYRKGS
                     KERQDLEAALAFYSKNITEVPLRIGDKKITNKLEQKQVIPSDHRSTLAKYTYATGEQI
                     QEAIDVALQARGAWERKPLKERAEILLRAADLAAGKYRMKLNASTMLGQGKNIIQAEI
                     DAACELIDFFRFNAVFAMELEHYEPISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGN
                     LPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPSDGPVFGDVITAS
                     PHLSAVNFTGSVPTFKTIWRKVAENLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAA
                     GTARSAWEYSGQKCSACSRMYAPKSIWPKILEKISAIHKEIKLGDVRDGSVFLSAVID
                     DKAFARLKAYIDFAKTGADGANVVLGGKCDDKTGYFIEPTLITVTDPKSKLLTEEMFG
                     PVVTVLVYEDSKVDEVLATVKDATPYGLTGAVFSQDKEFLYRARDVLRDAVGNMYLND
                     KSTGSIVGQQPFGGSRLSGTNDKAGGPHYGLRWTSPLTIKETSVSLTDWKYPSME"
ORIGIN      
        1 aaaatgctct cattcgcagc tcgacgctcc ttaatcacac aaaaatgcgc cgccagcacg
       61 tacagcggtc taacatcggc ggattttctc aaaaagaaga caaatgagcc gattttagag
      121 tatcgaaaag gaagcaaaga acgacaggat ttggaggcag cgttggcgtt ctacagcaag
      181 aacatcacag aagttccatt gagaattggc gacaagaaaa tcacgaataa attggagcag
      241 aagcaagtta ttccctctga ccatcgttca acacttgcca agtacactta tgccaccgga
      301 gagcaaattc aagaagccat cgatgtggct cttcaggcga gaggcgcctg ggagagaaaa
      361 ccgcttaaag aacgagctga aattttgctc cgcgccgccg atttggccgc tggaaagtac
      421 cgaatgaagc tgaacgcctc cacgatgctc ggccagggaa agaatattat tcaggctgaa
      481 attgacgccg cctgtgagct catcgatttc ttccgattca acgcggtttt cgctatggag
      541 ctggagcatt atgagccgat ttccacgaaa atcaccaaaa atacgatgca gttccgtgga
      601 atggagggat tcgtcgccgc aatcgcaccg ttcaatttta cggcgatcgg aggaaatttg
      661 ccgactgctc cggcgcttat gggtaacgtc tccctctgga agccatcgaa caccgccgtg
      721 ctctccaatt atataatcta cgaactcctc gaggaagctg gtatgccacc tggaattctc
      781 tcattcttgc catcagatgg ccccgttttc ggtgacgtca tcaccgcatc tccacacttg
      841 agcgctgtca atttcactgg ctccgtgcca actttcaaga cgatttggag aaaagtcgcc
      901 gagaatttgg ataactatgt gacttttccg aaactcatcg gagaatgcgg cggaaaaaac
      961 ttccactttg tgcatccatc cgcccacgtg gacgctgtcg ccgctggaac cgcccgttcc
     1021 gcctgggaat attcgggaca aaagtgctcg gcgtgctcca ggatgtacgc gccaaaatcg
     1081 atttggccaa agattctcga gaaaatctcg gcgattcaca aagagatcaa gcttggagat
     1141 gttcgcgatg gatccgtctt tctgtcggct gtgatcgatg ataaggcgtt tgccaggctc
     1201 aaggcctaca ttgactttgc gaaaaccgga gccgacggag caaatgtggt gctcggcgga
     1261 aaatgtgacg acaaaacggg atacttcatc gagccgaccc tgatcactgt gacggatccg
     1321 aagagcaagc ttctcactga ggaaatgttc ggaccggtgg tgacggtact ggtctacgag
     1381 gattcgaagg ttgatgaggt gctcgcgact gtgaaagacg cgacacctta tgggctgact
     1441 ggcgccgttt tttcgcagga taaggagttc ctttatagag ctcgcgatgt tctccgcgac
     1501 gccgtcggca acatgtacct caacgacaaa tcaactggat caatcgtcgg ccagcagcca
     1561 ttcggaggct ccagattgtc cggaaccaat gataaggccg gtggccccca ctatgggctc
     1621 cgatggacct cgccgctgac gattaaggag acgtcggtgt cattgactga ctggaaatat
     1681 ccatcaatgg aataattatg ttgttttttt cttttcattt ccgatttttc tcatattgag
     1741 aatatagttt tctttttgat taggtcaaca attattgctt taccactgaa ttttaatttt
     1801 ttttcccccg tgatcgcata ataaattttg ttttttt
//