Dbfetch

LOCUS       NM_060625               1739 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Histone deacetylase (hda-3), mRNA.
ACCESSION   NM_060625
VERSION     NM_060625.5
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1739)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1739)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1739)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1739)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003279).
            On Sep 4, 2019 this sequence version replaced NM_060625.4.
FEATURES             Location/Qualifiers
     source          1..1739
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="I"
     gene            1..1739
                     /gene="hda-3"
                     /locus_tag="CELE_R06C1.1"
                     /db_xref="GeneID:173074"
                     /db_xref="WormBase:WBGene00001836"
     CDS             8..1405
                     /gene="hda-3"
                     /locus_tag="CELE_R06C1.1"
                     /standard_name="R06C1.1"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Histone deacetylase"
                     /protein_id="NP_493026.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001836"
                     /db_xref="EnsemblGenomes-Tr:R06C1.1.1"
                     /db_xref="EnsemblGenomes-Tr:R06C1.1.2"
                     /db_xref="GeneID:173074"
                     /db_xref="GOA:G5ECH0"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="InterPro:IPR037138"
                     /db_xref="UniProtKB/TrEMBL:G5ECH0"
                     /db_xref="WormBase:WBGene00001836"
                     /translation="MSLQHSKSRVSYYYDGDFGNFYYGQGHPMKPHRVRMTHSLIVNY
                     GLYRKLNVMRPARASFSEITRYHSDDYINFLRNVKSDNMSTFTDQMARFSVGEDCPVF
                     DGMYEFCQLSCGGSLAAAARLNRQESEIAINWMGGLHHAKKSEASGFCYSNDIVLAIL
                     ELLKHHKRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKHGEYFPGTGDLKDVGAGSG
                     KYYALNVPLRDGVDDVTYERIFRTIMGEVMARFQPEAVVLQCGADSLAGDRLGVFNLT
                     TYGHGKCVEYMKSFNVPLLLVGGGGYTIRNVSRCWLYETAIALNQEVSDDLPLHDYFD
                     YFIPDYKLHIKPLAALSNFNTPEFIDQTIVALLENLKQLPHVPSVQMQSISTSCDSIV
                     KTFDEKLIRDHQNDDVRVTQFEEDVQVEDSAEFYDGQEPETKNIQSMKRHASPICAAQ
                     EEMKKNRIDGGENVA"
ORIGIN      
        1 cttccagatg agcctccaac actcgaaatc tcgagtttcc tactattatg atggagattt
       61 tggaaatttc tactatggac aaggacatcc aatgaaaccg catcgtgttc gaatgacaca
      121 tagccttatt gttaattatg gattatatcg gaagcttaat gtcatgcgtc ccgcccgtgc
      181 ttcattctcc gaaatcacac gttatcactc tgacgactat atcaatttcc ttcgtaacgt
      241 taaatccgat aatatgtcca cattcacaga tcaaatggcc cgattctcag ttggagagga
      301 ttgtcctgtc tttgatggaa tgtatgagtt ctgccagcta tcatgtggtg gatcactggc
      361 tgctgccgcc cggcttaatc gtcaagaatc agaaattgca attaactgga tgggtggtct
      421 acatcatgcg aagaaatcgg aagcttctgg attctgttac tcgaatgata ttgttctggc
      481 gattttggag cttttgaagc atcataaaag agttctttat attgatattg atgttcatca
      541 tggtgatgga gttgaggaag cattttatac gacagataga gttatgactg tttcatttca
      601 taaacatgga gaatatttcc ctggaactgg agatttaaag gacgttggcg ctggaagtgg
      661 caagtactat gctctgaatg ttccacttcg tgatggagtc gatgacgtca cttatgaacg
      721 gattttcaga acaattatgg gagaagttat ggcaagattt caaccagaag cagttgtgct
      781 ccaatgtggt gccgattcac tggcaggaga tcggctagga gtattcaatt tgactactta
      841 tggacacgga aaatgcgtgg aatacatgaa aagcttcaac gtgccgcttc tgttagttgg
      901 cggtggtgga tatacgattc gaaatgtctc cagatgttgg ctgtacgaga cggcgatcgc
      961 tttgaatcaa gaagtttcag atgatctgcc cctccacgac tactttgact acttcatccc
     1021 ggactacaaa ctacacataa agccgctcgc cgctctttcg aacttcaaca ctcctgaatt
     1081 cattgatcaa acgattgtcg cgcttttgga gaatttaaag caacttccac acgttccatc
     1141 ggtccaaatg caatcgattt cgacgagttg tgactcaatt gtgaagactt ttgacgagaa
     1201 actgatccga gatcatcaga atgatgacgt cagagttact cagttcgagg aagacgttca
     1261 ggtggaagat tcggcggaat tctacgatgg tcaagagccg gagacgaaga atattcaatc
     1321 gatgaaacgg cacgcgagtc cgatttgtgc ggcgcaagag gagatgaaga aaaatcggat
     1381 tgatggcggc gaaaatgtgg cataatttgg ttttaacttg attttctgta tgcactaact
     1441 ttgtatttat atcgtctctt caaactattt ctttaattta tacgaatctc aacttctcta
     1501 aacctctatt gatcctcaaa tctatttaaa tctttcgtta aatcgacaat taaaaaattt
     1561 ccgtcgtcaa gtgtggtgcc ggtggtgcat acaccgccgc gcacaaatgc acagatttcg
     1621 gcgttttcga atttttatcg gatttctttt ctctatattt taaaggatat tttctatcgt
     1681 ttcttgtcta aaaacacagt ttttatcgaa tttatcacaa tataaaccta tttatcatc
//