Dbfetch

LOCUS       NM_001356934             669 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Serpentine Receptor, class U (sru-20),
            partial mRNA.
ACCESSION   NM_001356934
VERSION     NM_001356934.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 669)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 669)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 669)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 669)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..669
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>669
                     /gene="sru-20"
                     /locus_tag="CELE_T04A11.7"
                     /db_xref="GeneID:188045"
                     /db_xref="WormBase:WBGene00005683"
     CDS             1..669
                     /gene="sru-20"
                     /locus_tag="CELE_T04A11.7"
                     /standard_name="T04A11.7c"
                     /note="Product from WormBase gene class sru;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serpentine Receptor, class U"
                     /protein_id="NP_001343704.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00005683"
                     /db_xref="EnsemblGenomes-Tr:T04A11.7c"
                     /db_xref="GeneID:188045"
                     /db_xref="GOA:A0A061AL70"
                     /db_xref="InterPro:IPR003839"
                     /db_xref="UniProtKB/TrEMBL:A0A061AL70"
                     /db_xref="WormBase:WBGene00005683"
                     /translation="MIYPVLLIVVRITPIQYPQSHREINSKILAYSIPFIHIYPIFFI
                     LHMIPALGVCRQLWKPYPFGCAFIHFYGSWHDLKNSPFEVINSVLWLIIFLICNFKLY
                     QKIQNLKGTSRGNSNVNQSSRYRRAEISLTLTSGSMILTYIVNFIFQASLNQPKIWNL
                     PFFQGTFIINFTLMTYSSFFRPYGYDLETCVVPWMLYLTHPAFQKRKESITVTPSLQR
                     ERIP"
ORIGIN      
        1 atgatctacc cggttttgtt gattgtagta cgaataaccc cgattcagta tccacaaagt
       61 catcgagaga tcaactcgaa aatacttgcc tatagtattc cattcattca catctaccct
      121 atattcttca tactccacat gataccagct ttaggggtct gccgacaatt atggaaacca
      181 tatccatttg gttgtgcttt tatacacttt tatgggtctt ggcacgatct caaaaactct
      241 ccatttgaag tgataaattc tgttttgtgg cttataatat ttctaatttg taacttcaag
      301 ctttatcaga aaattcagaa cttgaaaggg acttctcgtg gcaactccaa cgtgaatcaa
      361 agttcaagat atcgcagagc tgagatctca ctgacactga cttcaggttc aatgatccta
      421 acatatattg tgaattttat atttcaggca agcttgaacc aaccgaaaat ctggaattta
      481 cctttttttc agggaacttt tataattaat ttcactctga tgacatatag ttcgttcttc
      541 cgtccatatg gatatgatct cgagacatgt gtagttccat ggatgctcta tttaactcat
      601 ccagcatttc aaaaacggaa agaatcaatc actgtgacac caagtctaca aagagagagg
      661 attccataa
//