Dbfetch

LOCUS       NM_001312958            4357 bp    mRNA    linear   INV 27-MAY-2020
DEFINITION  Caenorhabditis elegans HUN domain-containing protein (pqn-80),
            partial mRNA.
ACCESSION   NM_001312958
VERSION     NM_001312958.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4357)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4357)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAY-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4357)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (21-APR-2020) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4357)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Apr 15, 2020 this sequence version replaced NM_001312958.2.
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..4357
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..>4357
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             8..4357
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14c"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="HUN domain-containing protein"
                     /protein_id="NP_001299887.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14c.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14c.2"
                     /db_xref="GeneID:176683"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AX73"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MDSLGSSKKKKKAEKSAKNEVIQIRISVAKPGSKKYTHVDWEEL
                     LKNNGKERDEDDLRRFYDEDTLFMAKKLGETRSKSGKKLRVNLDQLQHFNRKCGYDMD
                     DDFIDDTEIVDDEPTTSKKGGFYVGKGDVKDSNDEDEEEEEETDVEESIQEVPKKVKI
                     RKIKEKSGEKSSKSSDSSSSSSSDSEDAAGPPRMTGAPPSIRMVSSSSSLKKLPAPRK
                     PSPPPAVEPTRSVEIIEKPEKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIIL
                     IDDNAPAAKKQPESAQKGSTTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTAST
                     PKKEEIGTLETFLKNIFANLDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKV
                     NMEPLIYSLAKSFGMTTQEVMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAA
                     DWKLTQTDLPTMGEKDIQMLTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKK
                     FFDIINTLPDSSEKNGGGGQQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLK
                     HHSPPVEGLAKKQVIAANAIKEGVRKQISLFENKKETSSRLPGDPVYVFQFTEPVLTA
                     VAPYLEDLVDYALAAKKIELIVSGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVE
                     EPMKSRLKEANEQIMKHQVVQIPKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAA
                     KPSAPATPKASSSTALRPSTSSTPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQV
                     YAGKYLLPTGNSTADICDPTICLMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVG
                     QTRMAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKL
                     KKEKEKQAEKDRIEAKKFEERMKKEQEKQEEKERKEREKREEKERKEREIREIMERKK
                     REEDDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETEAANALQGLEEDLLMD
                     DIDFMTQQQTKVDEERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQ
                     KIQVKNEPVDHSFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSA
                     DMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQ
                     QSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAP
                     PVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPH
                     SNSSMIARSPQFPSHTSPMSQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSF
                     SSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNT
                     NYPPPPGYNHHGH"
ORIGIN      
        1 agacaaaatg gactcattgg gtagctcaaa gaagaagaaa aaagccgaaa agagcgcgaa
       61 aaacgaggtt attcaaattc gcatcagtgt cgcgaagccg ggcagcaaga aatacactca
      121 tgtcgattgg gaggaactgc tgaagaataa tggaaaagag cgggacgaag atgatctccg
      181 cagattttac gatgaagaca cactttttat ggcaaaaaag ctcggggaga cgagaagcaa
      241 aagtggaaag aaacttcgcg ttaatttgga ccagctgcaa catttcaacc gaaagtgtgg
      301 atatgatatg gatgatgact ttattgatga cacagaaata gttgacgacg agcctacaac
      361 atcgaaaaag ggtggatttt atgtgggaaa gggtgatgtg aaggattcaa acgacgagga
      421 tgaggaagaa gaagaagaaa ccgatgtgga agaatcgatt caggaagttc cgaagaaggt
      481 gaaaatcagg aaaatcaaag agaaatctgg cgaaaaatcc agtaaatcca gtgattcttc
      541 atcatcctcc tcgtccgatt cggaggatgc tgctgggcct ccgagaatga caggagctcc
      601 accgtcaatt cgaatggttt cttcttcttc ttctttgaag aagcttccgg cccctcgaaa
      661 accatccccg ccgccggctg tagagcccac aagatctgtg gaaattattg agaagcctga
      721 aaagactgaa aagcccgccg aaaagcgaaa aaccgcggcc accacatccg cactggagcc
      781 tgctgaaaag aagaaaaagc cggatagtag tagtagttcg gaggagataa ttcttattga
      841 tgataatgct ccggctgcaa agaagcagcc ggaaagtgct caaaaagggt ccaccacagt
      901 caccatgtca gccaagaaaa tctgcaaaca acaggaagaa atcgctaagc agaagccgtc
      961 atcatcatct gtaactccat caaaaccagc tgctccaaca gcttcaacac cgaaaaaaga
     1021 ggaaatcggg actcttgaga cgttcctgaa gaatatattt gcaaatttag atgcaaaagg
     1081 gaaactttat caggagaaaa agttgaaaac tttcgatacg gagactttaa aggagataac
     1141 aacgtttata gatgtaatga agcatcataa aactgaaaaa gttaatatgg aaccgttgat
     1201 ttattcgttg gcgaaatcat ttggaatgac tacgcaagaa gttatgaaac aggtcgaaca
     1261 agaaatttcg tcgaaaaagg caacaactcc aaaaccttca acaaatgcag ttttatcgac
     1321 aatttcatct caaaaatcat tggaaaaaaa tgcagccgat tggaaattaa cacaaacgga
     1381 tttacccaca atgggagaaa aagatataca aatgttgacg acaattgttc gatcatggaa
     1441 aagtaaaaaa gaaatatcga attcaatggt gactggatgg ctgaaagatg tgaatcaatt
     1501 gaaaatgaac gcagatcaag cgaggaaaaa attcttcgac atcataaata ctttgccgga
     1561 ttcgtctgaa aaaaatggtg gtggtggaca gcaagatgcc aacgatattc caaaacacga
     1621 acgatcacgt aaagctcgaa tgtttctcca ccaatgggtc tatttatctc gtaaattttt
     1681 ggagcttcaa cttccaaaat tgaaacatca ttctccacct gtcgaaggtc tcgcaaagaa
     1741 gcaagttatc gctgcaaatg caataaaaga aggtgttagg aagcaaattt cactttttga
     1801 aaataagaaa gaaacttcca gtcgtctgcc cggtgatcct gtctacgtat tccagtttac
     1861 ggagcctgtt ttaaccgcag tcgccccata cttggaagat ctcgtcgatt atgcgctcgc
     1921 ggcgaaaaaa atcgagttaa ttgtatccgg aatcgacgct ctacaccaat caactgacgg
     1981 aaaaattacc ataattcaat tttatattga aatctgccga agacttcaga aattatcatt
     2041 tctcgccgtt gaagaaccaa tgaaaagtcg tctgaaagaa gcaaatgaac aaattatgaa
     2101 gcatcaagtt gttcaaattc caaaatatca attgaaatgg cctgatggac aggcggagcc
     2161 atctctgaaa gggcttaatc gagagcttta tgaattcgac aaatcaattc tctccatggt
     2221 ggcggctaaa ccatcagctc ctgcaactcc aaaagcttca tcatctacag ccctccgccc
     2281 ttctacgtca tcaactccat ctcagcagca atccacgtca actgcaaaag ctatgacgtc
     2341 atcatcaaca tcagcagaag atgcgaagcg cttactcgca atgaatcaac ttgttcaggt
     2401 ttacgcggga aaatatctgc tcccgaccgg caattcaacg gcagacattt gtgatccaac
     2461 aatttgtcta atgaatgatg atattctact gattatggta acagctgtct attcgtgtgg
     2521 tataccattg gttaatcaaa tgaatatgct taaaaatgtc ctatgccaag ttggtcaaac
     2581 ccgaatggct cagacattgg caacacaaaa aactcaaaat aagcagtgcc tgacccaaaa
     2641 tgactatcaa ctactttttg attattttgg aaagtttgaa aaagcattag aacaacgaaa
     2701 agcaaaaaaa gaagaagctg aaagattgaa gaaattggag gaaaaattga aaaaagagaa
     2761 ggagaaacaa gcagagaaag atagaattga ggcgaagaaa ttcgaagagc ggatgaaaaa
     2821 agagcaagaa aaacaggaag aaaaagagag aaaagaacgg gaaaaacgag aggaaaagga
     2881 aaggaaagag agagaaattc gagaaattat ggagaggaaa aagagagaag aagacgatcg
     2941 aattgctgcg aaattacaaa ttgctcaaca attagagaat gacaggaaaa tgagagaagc
     3001 tgaagaaagt gcacggaagg agacggaacg gagggctaaa atggaaactg aagcagcaaa
     3061 tgcactacaa ggactcgaag aggaccttct catggatgat atcgatttta tgactcaaca
     3121 acaaacaaaa gtcgatgagg aacgaaaagt ggcggaagct cggcgagcag ttgaacgtga
     3181 gaatcagatc aaaatgatga gggctcaaca gctgcaaaga cggcaggaag aggctccgcc
     3241 ccctcaacaa gctccagctc cacatacaca aaagattcaa gtgaaaaatg agccagtaga
     3301 tcattcattc gatattctaa aagaagcaga aaaagatgca cacataattc caacaaaatc
     3361 aataaaagcc gagccgctgg acgttcaaaa accgcttagc gcatttgaaa agcttgcatc
     3421 acttcgtggt aggacccaat ctgctgatat gagaagaggc ggggactcta cggaaatgcc
     3481 gaatgtgaca caacaatatc aagcggagca aaatcatcta gcacaaagtt cgaataattc
     3541 tcagtacaat gcaccaagta caagttccca gccacaacat ttcccaacag agccttcaat
     3601 acgccaacca cctccccaac agagttacaa ttccaaccaa atgctccaaa atccacgaca
     3661 gcaaccccaa aaccaaattg tgcaaaattt ccaaagtgct ccgcaacgac atccccatca
     3721 aaatccgcaa attgccacgt catcttcatc tggaggagtc aatcagtttt ataataatgg
     3781 tggagctgca ccgccagttg tcgaacaaca agccgctaat agaagatcat cattcacaat
     3841 gtctcattca gttcaacaac accaatctcc tctccaacaa caatttccaa tcaattcata
     3901 tcaatcaccg agtcatcata ataatagtag ctcaatgagc aattcctcat taatgcaaac
     3961 accacacagt aatagttcaa tgattgcacg gagtccacaa tttccatctc atacgtcccc
     4021 aatgtcccaa cgattccata ccccaccatc agttgggcat caaatggtgc agagcccatt
     4081 gtctcaaccg aatccttcgc ctcttcaaca tttcaacttt tcgccacatt cctccagttt
     4141 ttcatcacaa agacctcaaa tgccgccaca acgtcaaatg agccaacaaa atctcatgca
     4201 tcaacagcaa caaccacaaa atcatactca acatcagtac caacatcaga cattcagttc
     4261 tcagcaacaa cagcttcaac aacatcaaca ccaaatccgg caccaaatga ataccaacta
     4321 cccaccgcca ccaggctaca atcatcatgg ccattaa
//