Dbfetch

LOCUS       NM_001307110             582 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase WNK (wnk-1),
            partial mRNA.
ACCESSION   NM_001307110
VERSION     NM_001307110.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 582)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 582)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 582)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 582)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..582
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>582
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /db_xref="GeneID:177743"
                     /db_xref="WormBase:WBGene00006941"
     CDS             1..582
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /standard_name="C46C2.1u"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase WNK"
                     /protein_id="NP_001294039.1"
                     /db_xref="GeneID:177743"
                     /db_xref="GOA:X5M5N0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024678"
                     /db_xref="UniProtKB/Swiss-Prot:X5M5N0"
                     /db_xref="WormBase:WBGene00006941"
                     /translation="MDLESEDPEVIQMIVRHRMEQHKLLEKQRVEIERLRSKIRVPRA
                     TSVNPEMIGDDEADTTLTALQSALGNASLSLPASPPPNTETTKVNTTVIPSDVLATRM
                     TMSQSSTKSSNVSVSSRHRDNQSAPPRHHHHQPHPPHHPHLQNHYHPPQNHTSATAPC
                     PSAMVQLQAVSNNNVNPLHQPPHPVSSQIPPQA"
ORIGIN      
        1 atggatttgg aaagcgaaga tcctgaggtg atccagatga ttgttcgtca tcgaatggaa
       61 caacacaaac ttctcgaaaa gcaacgtgtc gagattgagc gtcttcgttc gaaaattcga
      121 gttccacgtg caacttctgt gaatcccgaa atgattggag atgatgaagc tgatacgacg
      181 cttactgctc ttcaaagtgc attaggcaat gcttcattgt cattgccagc cagtccgcca
      241 cctaatactg agacaacgaa ggtcaacacc actgtaattc cttccgatgt attggcgacc
      301 cgaatgacaa tgtctcaatc gtcaaccaaa tcaagcaacg tctcggtatc atcccgtcat
      361 cgcgacaatc agtccgctcc gccacgtcat catcaccatc aaccccaccc tcctcatcat
      421 ccgcacctcc aaaatcacta tcatccccca caaaatcata cgtcagccac tgctccttgt
      481 ccatcggcta tggttcaact gcaagcagtg agcaacaaca acgtgaaccc tctccatcag
      541 ccaccacatc cagtttcctc tcagatcccg ccacaggcgt aa
//