Dbfetch

LOCUS       NM_001307109            5055 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase WNK (wnk-1),
            partial mRNA.
ACCESSION   NM_001307109
VERSION     NM_001307109.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5055)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5055)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5055)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5055)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5055
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>5055
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /db_xref="GeneID:177743"
                     /db_xref="WormBase:WBGene00006941"
     CDS             1..5055
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /standard_name="C46C2.1t"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase WNK"
                     /protein_id="NP_001294038.1"
                     /db_xref="GeneID:177743"
                     /db_xref="GOA:X5M5N0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024678"
                     /db_xref="UniProtKB/Swiss-Prot:X5M5N0"
                     /db_xref="WormBase:WBGene00006941"
                     /translation="MPDSITNGGRPPAPPSSVSSTTASTTGNFGTRRRLVNRIKKVDE
                     LHPAQENPTMGSHWLSEQERSRLEAVQQDWRRTRPMKWTSKKRPDDPTTSSPSTVSIS
                     NALENSTPSLNNVSSITNSSSPFSLSSAATSTASAIIPFTSNVATNHPHLNHHVSRIP
                     QAIVTGGTNGSLPPLLISPTSAAAATPLISGKAGPMSPSTGSPINVAATVLQNAVSSP
                     QHSIFDRSRLNKIPPNTSLASSSSPSDAANNDKPIQQRHSILSNVRTLTQAMVNDGPR
                     TLTGDDMDKMVSEEERARKEQEKREEEEKAARRIDVEDDFDAQEKPIDKSKNGRFLKF
                     DEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQRFREEAEMLKDLQHPNIV
                     RFYDYWESADLCGKRKYIVLVTELMTSGTLKMYLKRFKRINIKVLKSWCRQILKGLSF
                     LHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTPEFMAPEMY
                     EEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPE
                     IREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLNDLNVEIQMQL
                     RVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDEDTRMITKLIKDK
                     VDAFRRDRDHRLLEIKRAKEEEERIREEAEIKEELRLRAEAKEKEKERLEKERLEKKA
                     AAAAAANPNPTPIPPTPATPHSSAQQQPIPPPLSTQTSAEIQQSAQQPSVPVTMIANI
                     PAMSPTSAQPQPVLSPTSAAVPVPTTMIHVPKPSEIPVQNVATTAAPVAANNVPPSPA
                     PFKTEDIQTPTLAQNTVPRTISTDASGLVINTPASIASPSPAPSATDVASTTAPVTPA
                     PTPTTTTDGGAAAASTTTENKEEKRKSNKRKVVMEILGCDESRNFALVSCRLDTSHKS
                     VTFQFAPGTDKPCTIATKLLAEDCLLKVHVHIVEAQLGEVIQLINSDGKKGVGTKLAT
                     VLDPNSTEPPTITAVMPKDSSAATASNTKPKIEIEKTPPTRDASQEPNNVQVTNVRKV
                     SQESNAESVQSIPRPGGIIVMSPTNQTDSAPPPTGAAAKPSRFQVTKSADPIATPISS
                     SISTATVIPIVAATPTNITSEPVIVQPITAQVITHLATPSPVSHSLSSNSSPSATTHS
                     NMSSIQSTTSVPGRRFTVQPVSQAESGISSSISTPHPEPTPAITSCPPPVPSVPPVVS
                     NGTLNLEVAPKQTPSATNQNVDTQHSSSTASTATLVSETPATVHVTPISVPAPVQEPL
                     VIDHHSDVLTQLDSELRKVSGVSHSASPSTVVESLTSMTPQTIPLACQTVPASIGQAP
                     AVIAAAHAASLIPNASVPQSPSRLDAETGLAGLHEKLEALKMEQDRREDMGDDAIGTT
                     TTDGKDEIPIDTLKGLAEALGKVIHADGRETTPMPPDHPDLTDASTGQMDLESEDPEV
                     IQMIVRHRMEQHKLLEKQRVEIERLRSKIRVPRATSVNPEMIGDDEADTTLTALQSAL
                     GNASLSLPASPPPNTEIPDNEGQHHCNSFRCIGDPNDNVSIVNQIKQRLGIIPSSRQS
                     VRSATSSSPSTPPSSSSAPPKSLSSPTKSYVSHCSLSIGYGSTASSEQQQREPSPSAT
                     TSSFLSDPATGVIENV"
ORIGIN      
        1 atgcctgatt ctataacaaa cggtggacga ccaccagcac ctccaagctc tgtgagctca
       61 acaacagcat cgacaactgg taattttggt actcgacgtc gtttagtgaa tcgtatcaag
      121 aaagtcgatg aactacatcc agcacaagag aatcccacaa tgggatcaca ctggttgtcc
      181 gagcaagaaa gatcacgact tgaagctgtt caacaggatt ggcgaagaac tcgaccaatg
      241 aaatggactt caaaaaagag accagatgat ccaacgacat catctccatc gacagtttca
      301 attagtaatg cattggaaaa ttcaacacct tcattaaaca atgtttcttc gatcacaaac
      361 tcttcatcac cattttcttt atcgtcagct gcaacatcga cagcttctgc cataatccca
      421 tttacctcaa atgtagctac aaatcatcca catcttaatc accacgtgtc gagaatacca
      481 caggcgattg taacaggagg gacaaatggt tcattacctc cattattaat atcaccgacg
      541 tcagcagcag ccgcaacgcc gttgatttca ggaaaagcgg gtccaatgtc accatcaacg
      601 ggaagtccaa ttaatgtggc tgctacagta ttacagaatg cagtttcaag tccacaacat
      661 agtatttttg atagatctag gttaaataaa attccaccaa acacatcatt agcatcgtct
      721 tcgtctccga gtgatgctgc taacaatgat aaacctatac aacaacgtca tagtatttta
      781 tcgaatgttc gaactctcac tcaagcaatg gtaaacgatg gaccacgaac gttgactgga
      841 gatgatatgg acaagatggt cagtgaagag gaaagagcac gaaaagagca agagaagcga
      901 gaagaagaag agaaagcagc acggagaatt gatgttgaag atgattttga tgcgcaagaa
      961 aaacccattg ataagagtaa aaatggtcga ttcttaaagt tcgacgaaga acttggtcgc
     1021 ggatcgttca agacagtgtt tcgagggttg gacactgaaa ccggagtggc cgttgcgtgg
     1081 tgtgagcttc aggagagtaa actgaataag actgaaaggc aacgttttcg agaagaagct
     1141 gaaatgctca aggatctgca acatccgaac atcgtacgat tctacgatta ttgggagagt
     1201 gcggatttgt gtggaaaacg gaaatatatt gtgcttgtaa ccgaattgat gacttcagga
     1261 acattaaaaa tgtatttgaa gcgatttaaa cggataaaca taaaggtatt gaaatcttgg
     1321 tgcagacaaa ttctgaaagg gctttcattt cttcacacac gtaatccacc tgtaattcat
     1381 cgtgatctca agtgtgataa tatctttatc actggtacaa ctggtagtgt aaagattgga
     1441 gatcttggat tggcaactct taaaaataaa tcattcgcga aatctgtcat tggaactcca
     1501 gaattcatgg caccggaaat gtacgaagag atgtatgatg agagtgtaga tgtctacgcg
     1561 tttggaatgt gtcttcttga aatggttacc ggagaatatc catattctga gtgtatgaat
     1621 ccagcgacaa tctacagaaa agtgatatca ggtgtcaaac cagaatgttt ctcaagaatt
     1681 cctgcacaat atcctgaaat acgtgagata atcgatcggt gtattcgtgt gagacgagaa
     1741 gagagaagta ccgtgaagca attgctcgtt gacgatttct tcactccaga agatctcatc
     1801 ggaattcgtg ttgaaattaa gaatcgggat gctgatctca atgatcttaa cgtggaaatt
     1861 caaatgcaac tccgagttta cgatgagaaa aagagaaaac aatatcggtt caaggagaac
     1921 gaaggacttc aatttgcatt tgatattgaa aatgacagcc cagatgaagt tgttcaacag
     1981 atgatcgagc aacaacatat tccagatgag gatactcgaa tgataacaaa gttgataaaa
     2041 gacaaagtgg atgcgttcag aagagatcga gatcatcgtt tattggagat taaaagagca
     2101 aaagaggagg aagaaaggat acgagaagag gctgagatta aagaggaatt gaggttgaga
     2161 gctgaagcta aagaaaagga aaaggagagg ttggagaaag aacgattaga aaaaaaagct
     2221 gcagctgcgg ccgcagccaa tccgaatcct acaccaattc caccaactcc agcaacacca
     2281 cactcttctg cccaacaaca gcctattcca ccaccactat caactcaaac ttcggctgaa
     2341 atacagcagt ctgctcaaca gccatctgta cctgtaacta tgatcgcaaa tatcccagct
     2401 atgtcgccaa catcagctca accacaacct gttttatcac caacaagtgc agcggttcca
     2461 gttccaacga caatgattca tgttccaaaa cctagcgaga ttccagtgca gaatgtagcg
     2521 acgactgcag ccccggttgc ggctaacaat gtaccaccat caccagctcc attcaaaaca
     2581 gaagatatcc aaactcccac acttgcccag aatacggttc cacgaacaat ctccactgat
     2641 gcttctggac ttgtcatcaa tactcctgca tcaatagcat caccatcacc tgctccttcg
     2701 gctactgatg ttgcttcaac aacggctcca gtcacccctg ctccaactcc aacaacaaca
     2761 acggacggtg gtgcagcagc agcttcaaca acaactgaaa acaaggaaga aaagcgaaaa
     2821 agcaacaaaa gaaaagtggt aatggagatt ttgggatgtg atgaatcgag gaattttgca
     2881 ttggtctcgt gtcgacttga cacttctcat aaatctgtta ccttccaatt tgcaccagga
     2941 actgacaaac catgcacaat tgcaacgaaa cttttggctg aagattgtct tttaaaagtt
     3001 catgttcata ttgttgaagc acaattggga gaagttattc aattgattaa ttctgatgga
     3061 aagaaaggtg ttggtactaa attagcgacg gtattggatc caaatagtac tgaaccacca
     3121 actatcactg ctgtcatgcc aaaggattcc tctgccgcaa ctgcttctaa tactaagcct
     3181 aagattgaaa tcgagaaaac gccaccaacg agagatgctt cccaagagcc gaataatgtt
     3241 caggttacga acgtacgcaa agtttcacaa gaatcaaatg ccgaaagtgt tcaatcaatt
     3301 cctcgtccag gtggaatcat tgtgatgtcc ccaacaaatc aaacagattc ggctccgccc
     3361 ccaactggag ctgcagcaaa accatcacga ttccaagtaa caaagtcagc ggatcctata
     3421 gctacaccga tatcttcgtc aatatccaca gcaacagtta tcccaattgt tgcagcaaca
     3481 cctacgaata tcacatccga accggtcatt gtccaaccaa tcactgcaca agttataacc
     3541 catttggcta caccatcgcc agtttctcat tcgttatcat caaattcttc tccaagtgct
     3601 acaactcatt cgaatatgtc atcaattcaa tcaacgacta gcgttcctgg aagacgattc
     3661 acagttcagc ccgtctctca agcagaatcc ggaatatctt cgtcaatttc tacgcctcat
     3721 ccggaaccga cgccagcaat cacttcgtgt cctccaccag ttccaagtgt cccaccagtg
     3781 gtgtccaatg ggacattgaa cttagaagtt gctcctaaac agactccatc agcaactaac
     3841 caaaatgtcg atacacaaca ttcatcgtca acagcatcaa cagctacatt agtttcggag
     3901 acacctgcta cagtacatgt tactccgatc tcagtgccag ctcctgttca agaaccatta
     3961 gtcatcgatc atcattctga tgtattgaca caattggata gtgagttgag aaaggtcagt
     4021 ggagtatcac actcggcttc accttcaacg gtagtcgagt cgctcacctc aatgactcca
     4081 caaacaattc cattggcttg tcaaactgtg cccgcatcga tcggtcaagc tccagcagtc
     4141 atcgcagctg cacacgcggc gtcattaatt ccaaatgcaa gtgttccaca gtcacctagt
     4201 cgtcttgatg ccgaaactgg acttgccggt cttcacgaga agcttgaagc gctgaaaatg
     4261 gaacaggatc gacgagaaga tatgggagat gatgcgattg gcacaacaac cacagacgga
     4321 aaggacgaga taccgattga tacgttaaaa gggctcgcgg aagcattagg aaaagttatt
     4381 catgcggatg gtagagaaac aacaccaatg ccaccggatc atccggattt aacagatgct
     4441 tcaacgggtc aaatggattt ggaaagcgaa gatcctgagg tgatccagat gattgttcgt
     4501 catcgaatgg aacaacacaa acttctcgaa aagcaacgtg tcgagattga gcgtcttcgt
     4561 tcgaaaattc gagttccacg tgcaacttct gtgaatcccg aaatgattgg agatgatgaa
     4621 gctgatacga cgcttactgc tcttcaaagt gcattaggca atgcttcatt gtcattgcca
     4681 gccagtccgc cacctaatac tgagattcca gacaacgaag gtcaacacca ctgtaattcc
     4741 ttccgatgta ttggcgaccc gaatgacaat gtctcaatcg tcaaccaaat caagcaacgt
     4801 ctcggtatca tcccgtcatc gcgacaatca gtccgctccg ccacgtcatc atcaccatca
     4861 accccaccct cctcatcatc cgcacctcca aaatcactat catcccccac aaaatcatac
     4921 gtcagccact gctccttgtc catcggctat ggttcaactg caagcagtga gcaacaacaa
     4981 cgtgaaccct ctccatcagc caccacatcc agtttcctct cagatcccgc cacaggcgta
     5041 atagaaaatg tatga
//