Dbfetch

LOCUS       NM_001307053            5061 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001307053
VERSION     NM_001307053.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5061)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5061)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5061)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5061)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5061
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>5061
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..5061
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1k"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001293982.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1k"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:A0A061AL01"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:A0A061AL01"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MLQLKFFHGPWSRATSPRRAENDPPTSTTEAAAVASTSGTQGRA
                     HAAGDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVILLS
                     LAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPELSQIDRGVGADNCSHGNISM
                     PEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKVFP
                     DFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVLFA
                     LNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFNLS
                     YLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREGEDNDSIYNDGNFVIKPENPQ
                     YDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNN
                     LYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCI
                     VRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSWYF
                     QHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQKQI
                     ERGAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLVEPVDSFVPEVDPKATAYDRLDP
                     GQIMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALIAVSEPEARKPGGTEETDGDEDE
                     DNKDSKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESL
                     SNTSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGA
                     HTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVI
                     KFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLR
                     KLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVI
                     PSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFL
                     IMTFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLI
                     YQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCI
                     GNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFN
                     IKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMP
                     EKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSIL
                     RSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEF
                     TRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPN
                     QGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIAT
                     SEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILV
                     VGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLF
                     RSPATLIEWTRMSKKKQE"
     STS             425..1300
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             2323..3356
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgctccaac tcaagttttt ccatggacca tggagtcgag caacgtcacc aagaagagca
       61 gaaaatgatc cacctacaag tacgacggag gctgcggcgg tagcaagcac atctggaaca
      121 caaggaagag cacatgctgc aggcgatacc cttgtcaaga agctgcacaa attggcaaat
      181 cagacaatcg aactgttatg gaggtttttc gaagttcaca tttcgaaaat tgtctttgtc
      241 atcattgcga tttttattgc caacaatatc aatgctctat acattccact tgttattctc
      301 ctctcattgg ctatatgtct accatcagct gcagatggga tattctcttt atttatgtgt
      361 gcctacttat tcctcgtggc actgagcaag atgatctacc aactggatat tgttcccgag
      421 ttatcacaaa tcgaccgagg agttggagca gataactgtt cacatggaaa tatttcaatg
      481 cctgaatggt ttggattgaa gaaggaagtt gaaggaactg aaccaattta tatgctcttt
      541 ggagtcattg tttcgattat tgcattggct tttcaatcaa ttgttatata tcgacaaaga
      601 cattatcgag cttcactggg acttcctgaa tcgatgcgag ctaaagtgtt cccggacttc
      661 catcattctc attttgatag atctctcaaa aatgccatcc aattcttgat agactatggt
      721 ttctataagt ttggacttga aatcacgatg atcgccattg gaattgacat tttcaatcga
      781 atggatgcat tggcagcgat tcaatgtttc tggcttgtcc tgtttgcgct caataaaaga
      841 gtctttgttc gaagaatatg ggtattctat gtgatctata tggcgattct gtatccactt
      901 cagttctttt catatgttgg attaccacct gacagttgta ttgagtatcc atggtcgtat
      961 tggattccat cgtatagtga tgatgcgaga ttcaatctgt cgtatcttct gaacttgtca
     1021 atatacggtg taaactggcc atcagcatat ctcattggcg atttcttcgt actcctcttg
     1081 gcatcatgcc aattagcagt tttccggcga gaaggagaag ataatgattc aatttacaat
     1141 gatggaaact ttgtgattaa gccagaaaat ccacaatatg actttattga caccaaaaag
     1201 agttacgttg attatttcaa atcattcgtt ttccattatg gacactggat tacattgatg
     1261 tctacactag cagcaggaat tgctggaacg tcactttttg ctttgggata cattatattc
     1321 actctgacaa tgctgtggtc tggtaacaat ttgtatgtga tgaactcaac tctacgatca
     1381 tttgaacata ctttgaaacg atggaatgca cttttgggat acacattgtt cacgattaca
     1441 atgaaagttt gccttcaaat atttggatgt gtattcctgt cgtggttcga tcaatctggt
     1501 ggatggggaa agactctgtg catcgttcgt caactcttca gtatcacatg tgttaataac
     1561 gaatgtcatg tgctcaaaga gctggaggat ttctcgaagg cgtgtgctgt tgagacgaaa
     1621 gaaggaaata ttggatttga tgtgattgcg ctatccttcc tcgtcttcca aatccgaatt
     1681 ttccattctt ggtatttcca acactgcatg gttgaatatc gaagtgaggt tattctggcc
     1741 aatagaggtg ccgtgctgaa gaatcaactg attgaaaagg aaatgaagga acaaaacgag
     1801 cagcaaaaag ccaagttcaa tgatatcaga agaagaactg aagctattcg tgaaagatat
     1861 caaaaacaaa tcgaacgagg agctgctgaa cgtgacttcg agccggttac ttatgggcac
     1921 gccaaacgag cgggagacta ctacatgttc aaatacgatc ctgaaaatga tgatcttgtg
     1981 gaacccgtcg acagttttgt accagaagtt gatcccaagg caactgcata tgatcgactt
     2041 gatcctggac agataatgta cgctgccacc gctcacgacc tcgacctcgc caaaactgta
     2101 cagcaagtca agaaaggcga tactatcaaa gatcctgatt cacgtgctct tatcgctgtt
     2161 tctgaaccag aagctcgtaa gccaggaggc actgaagaaa cggatggtga tgaagatgag
     2221 gataataagg attcgaaagt ggaaagtact gctaaattca ttcaaaaaat gatcgcttct
     2281 gccttggact tgtgtagtgt aacactaaac aaactgtgca gagaacaccg atatgttgga
     2341 tttgttttga gcaaggaaaa acaaaagttg aagtcaggac actcggaatc tctttcaaat
     2401 acatctagaa agctgacgga tattcgatct gcagttgatc taccaagtct tcaacttgtg
     2461 caatcggcga atgatgttga aaagatggag acagccgtca gcgtggattg gcaacaaaaa
     2521 tcatcagcaa cgagactatt gaatgcagtt gtgaattgta ttggagcaca cactgatatt
     2581 ctctgctact tcttcgcaat tatgacacaa gtgatgactg gtggacttat tactcttcca
     2641 cttcctctga tgtcactatt ctggggaaat ctatcgaatc ctcgtccatc caagttcttc
     2701 tgggtcacaa tgatcaccta cactgagtgt gtcattgtta tcaagtttgt ttgccaattt
     2761 gcattcatgc cttacaattc tatcacgtgg cgaacagagc atcaaatgga cccgatgtca
     2821 ttggataagt tattcggagt atcacagaga gatagttttg cactttggga cattgttttg
     2881 ctcttctcac tcttcttcca tcggtatatg ctcagaaagt tagggttatg gaaggatgcc
     2941 aatttgacgg acacgttcac tttgaaggaa gagcctcgat cggcgtcagg atcggacaca
     3001 ggatcaccca agaaaattgc tcaagagcca aaggttgttg taactcagtc agataccctt
     3061 gaaggtacaa gtggaggaga gatagtcata ccatctgatc caaatgcagt ttccaatatg
     3121 gaagaattag actgcgaacc tccgattcca gagaagcaaa gtggaccaat tggaagattc
     3181 attcatcaat tattccatcc aaaattccgt tacattcgtg atttgtatcc aataatgttt
     3241 ggaatcgatg tgatatgctt cctcatcatg acatttggat actcggcatt tggtgaagga
     3301 ggttctggaa atgttttaga tgatgtgaag gcttctcgta ttccggtaac acttgttgtt
     3361 atgctcgttg gaatgactct ggcaattatc attgatcgag cactctacct cagaaaatca
     3421 gttgtcggaa agctaatcta tcaagtctta atgattgctt tccttcacat ttgggtattc
     3481 cttgttcttc caaatatgac tcgtcgttct gcgatatcga atcacgttgc tcaagcattg
     3541 tacgtcatca aatcgtgcta tttccttgtg tctgcttggc agatccgaaa tggttatcct
     3601 gaactttgta ttggaaatct attaacacat tcatacggaa tgaccaatat gattgcattc
     3661 aaagtattca tgaatattcc attcctcttc gagcttcgta cagctattga ttggacatgg
     3721 acagatactt caatgcctct tttcgatttc ttcaatatgg aaaatttcta tgctcatata
     3781 ttcaatatca agtgtgcccg ccagttcgaa gctgcctatc cagctccaag agggattccc
     3841 aaaggaaagt tggtcaagta tatgatggga ttcccaatta tcattggagt cgttatcttc
     3901 atcttttctc ctctattgct ctggtcgcta ctcaatcaaa tcggaactat cagtatgcca
     3961 gaaaaagtta cgttgaggat ttcgattgaa ggatatccac cactttacga gatggaggca
     4021 caaggaagta atcacgataa cgctgaactt ggaatgataa aacctgatca attggcatct
     4081 ttgaatcaag cattgacgga tagttacacg acacgagaca ctaattctat tttaagatca
     4141 agaatgtctg tatcatatct gaaaggatac acatatgagg atattctgat tgtgcgattc
     4201 cgtccagaat ctgaaattta ttggccgatt tcacaggatt cgagaaatgc gatgatcgat
     4261 aaattgagcc gaaacacgtc agtcaatttt gaagtatctc tggaattcac tcggccatat
     4321 gatccaaatg aaaacgctgc tttaaaacat tcgaaatcgt ggcttgttcc aatctccctg
     4381 gatatgacga ttcgagcaaa aattcaaagt gctctccgag gagatccagg tcatccgatt
     4441 ctcattccac agtcaattcc tgcgtttatt caagttccaa atcaaggaga attgaccctt
     4501 ccaacatcaa tcggaaatac tattatcaat gacggaaatc cacggattaa tacgaccggg
     4561 atggaaaaat cagacgaagc tcgggcttgg ttcgactcgt taaccttgaa tctcgaacaa
     4621 ggaaaatcgc aaaacgagaa aatgtggatc gccacatccg aacatccagg agaccaaaat
     4681 gcgaaactct ggataaagac tgcaaatacg acgtattcgg gaaggccgta ccttcaagtt
     4741 gtcggattta ttgatagagc attcccatca tttttggcga aagttttcaa aggaggagtc
     4801 attgcagtgt atctttcagt tatcctcgtc gttggaagag gtctggttcg tggaatcttc
     4861 accacatctc caagcactgt catgttcaca gaattaccga atgcggatca tcttctcaaa
     4921 atttgtctcg acatctattt ggttcgagaa gcgaaggact tcatgttgga gcaggatctc
     4981 ttcgccaaat taatattcct gttccgatca ccagcgacac tcatcgaatg gacacgaatg
     5041 agcaaaaaga agcaagaata a
//