Dbfetch

LOCUS       NM_001307052            7215 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001307052
VERSION     NM_001307052.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 7215)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 7215)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7215)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 7215)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..7215
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>7215
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..7215
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1h"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001293981.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1h"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:A0A061AJB7"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:A0A061AJB7"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MTVPPLLKSCVVKLLLPAALLAAAIIRPSFLSIGYVLLALVSAV
                     LPPIRKSLALPKLVGTFVIITFLFCLAVALGVGSYQISEQVVHKNDRTYICNRSDTTL
                     FRSIGLVRFHPTGTFESTRAFLPEIIATSAALLTIIIVMFLSHRDEQLDVVGDVVTVR
                     SESGREQRRQRKLAAIMWSAIGNSLRRLTNFVLFLFTAYVGIVKPSLSNSIYFLAFLF
                     ISTWWSTYTPLRHGVYNQIKKFLIFYSALHFLVLYTYQIPIVHHSWLPTGSFLPRLFG
                     LTVLMDSSCPEWWKFPFVAPDFNDDDLIMKWPLYANPIVVLVFFYLTVAQYKFTRNGS
                     REYIDDNEYGSSVHEELLSNASSSANDDEQGRARSRSPLRNGEEQGSIPLRKVTSQVV
                     DRNKLSNIFNTTAPGDKESAASKGMIAVMTFVIFHSYSIALTAMMTWALLYHSIFGLI
                     LLILTCILWIFRDTRKSSFAMAPIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGI
                     EWTTLPVHAVIILCVQTLLTLPVFLLLRLARREKFYESLSDYERQRRINSYGTFGASK
                     TGAGGVAVAKFQDPKSRKFAAFVEYLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILF
                     FALWALNLIYLKFSFRLYRGLAYAFWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSL
                     SQEWLNAIGLVDFRAIGESGALFLQLLAPIALFVVTMLQLKFFHGPWSRATSPRRAEN
                     DPPTSTTEAAAVASTSGTQGRAHAAGDTLVKKLHKLANQTIELLWRFFEVHISKIVFV
                     IIAIFIANNINALYIPLVILLSLAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIV
                     PELSQIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVI
                     YRQRHYRASLGLPESMRAKVFPDFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIG
                     IDIFNRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDS
                     CIEYPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRR
                     EGEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIA
                     GTSLFALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQ
                     IFGCVFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNI
                     GFDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQ
                     KAKFNDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLV
                     EPVDSFVPEVDPKATAYDRLDPGQIMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALI
                     AVSEPEARKPGGTEETDGDEDEDNKDSKVESTAKFIQKMIASALDLCSVTLNKLCREH
                     RYVGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVS
                     VDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLS
                     NPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQR
                     DSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQ
                     EPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFH
                     PKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVG
                     MTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYV
                     IKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTW
                     TDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVV
                     IFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPD
                     QLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDS
                     RNAMIDKLSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSAL
                     RGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAW
                     FDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAF
                     PSFLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIY
                     LVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE"
     STS             2579..3454
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             4477..5510
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgacggtcc cgccgctttt aaaatcgtgc gtcgtcaaat tgctgcttcc ggcagcactg
       61 cttgcagctg ccataatccg gccgagcttt ttatcaattg gctacgtcct acttgcactt
      121 gtcagcgccg ttctgccacc aattcgaaag tctttagcac ttcccaaact agttggaaca
      181 ttcgttatta tcacttttct cttctgccta gcagtcgcac taggagttgg ttcctaccag
      241 atctcagaac aagttgttca taaaaatgac cggacataca tttgcaatcg atccgacact
      301 actctgttcc ggagcattgg ccttgtccga ttccatccaa caggaacatt tgaatcaact
      361 cgagcatttc ttccggagat tattgccacg tctgcagctc tgctcactat cataatcgtc
      421 atgtttttgt cgcatagaga cgagcaattg gacgtcgttg gtgatgttgt aacagtcagg
      481 agtgaatctg gccgcgagca acgacgacaa agaaagttag ccgctataat gtggagtgca
      541 atcggaaatt ctctacgaag attgactaat ttcgtgcttt tcctgttcac ggcatatgtt
      601 ggaatcgtga aaccatcgct gagtaactca atttactttc tcgcttttct gttcatatcc
      661 acgtggtggt ccacatacac accactgaga catggagtgt acaatcagat aaagaagttt
      721 ctcatattct actcggcgct tcatttcttg gttctctaca catatcaaat tccgatcgtt
      781 caccactcat ggctgccgac cggttcattt ctgccacgtc tgttcggact tactgtactc
      841 atggattcat catgtcccga atggtggaag tttccatttg tagctccaga ctttaacgat
      901 gatgatttga ttatgaaatg gccgttgtat gcaaatccga ttgttgtact ggtgttcttc
      961 tacctcacag ttgctcaata caaattcacg agaaacggat ctcgtgaata tatcgatgat
     1021 aacgaatatg ggtcatcagt tcacgaagaa cttctgtcca atgcatcctc ctctgctaat
     1081 gatgatgaac agggtcgagc tcgttcgcga tctccgctgc gaaatggtga agaacaaggc
     1141 tcaatcccac tacggaaagt tacttcgcaa gttgttgata ggaataagtt gagcaacatt
     1201 tttaatacta cagcacccgg agataaggaa tctgctgctt cgaaaggaat gattgcagtc
     1261 atgacatttg tcattttcca ttcgtattca atcgcgctga ctgctatgat gacatgggct
     1321 ctcctctatc attcgatatt cggtctcatt ctcctcatcc tcacatgtat cttgtggatc
     1381 ttccgtgata cgagaaagtc atcgtttgca atggccccta ttattttgat gtatatcgag
     1441 tttctattga ttcttcaata tttcctcagt atggatattc atgcagaaat tggcgatcca
     1501 gcgtggatga actttgttgg aatcgaatgg actactcttc cagtacatgc tgtcatcatt
     1561 ctctgtgtcc agactcttct cactctccca gtgttcttgc ttctacgttt ggctcgcagg
     1621 gagaagtttt acgaatcgct gagtgattat gaacgacaac gacgaatcaa ctcatatgga
     1681 acatttggag catcaaagac tggagctggg ggtgttgcag tggctaagtt tcaggatcca
     1741 aaaagtcgga agttcgcggc atttgtggaa tatctgtcga ataaagtgtc tgtctacttc
     1801 atatttgtag tatcagtggt acttttggtg gtctctacgt gttttgctcc gaatttctac
     1861 aatattctat tcttcgcact atgggcattg aacttgattt atctcaagtt ctcattccgt
     1921 ctgtatcgtg gattggcata tgcattctgg ctaactctca cgttctacac ttcaattgtt
     1981 attatcgccc tctacattta tcagttccct ggagtatctc aatggattat tcgaaatact
     2041 agtttgtcgc aggagtggct gaatgcaatt ggacttgtcg attttagagc tatcggtgaa
     2101 tcgggagccc tatttctaca attactcgcc ccaattgcct tgttcgtcgt cacaatgctc
     2161 caactcaagt ttttccatgg accatggagt cgagcaacgt caccaagaag agcagaaaat
     2221 gatccaccta caagtacgac ggaggctgcg gcggtagcaa gcacatctgg aacacaagga
     2281 agagcacatg ctgcaggcga tacccttgtc aagaagctgc acaaattggc aaatcagaca
     2341 atcgaactgt tatggaggtt tttcgaagtt cacatttcga aaattgtctt tgtcatcatt
     2401 gcgattttta ttgccaacaa tatcaatgct ctatacattc cacttgttat tctcctctca
     2461 ttggctatat gtctaccatc agctgcagat gggatattct ctttatttat gtgtgcctac
     2521 ttattcctcg tggcactgag caagatgatc taccaactgg atattgttcc cgagttatca
     2581 caaatcgacc gaggagttgg agcagataac tgttcacatg gaaatatttc aatgcctgaa
     2641 tggtttggat tgaagaagga agttgaagga actgaaccaa tttatatgct ctttggagtc
     2701 attgtttcga ttattgcatt ggcttttcaa tcaattgtta tatatcgaca aagacattat
     2761 cgagcttcac tgggacttcc tgaatcgatg cgagctaaag tgttcccgga cttccatcat
     2821 tctcattttg atagatctct caaaaatgcc atccaattct tgatagacta tggtttctat
     2881 aagtttggac ttgaaatcac gatgatcgcc attggaattg acattttcaa tcgaatggat
     2941 gcattggcag cgattcaatg tttctggctt gtcctgtttg cgctcaataa aagagtcttt
     3001 gttcgaagaa tatgggtatt ctatgtgatc tatatggcga ttctgtatcc acttcagttc
     3061 ttttcatatg ttggattacc acctgacagt tgtattgagt atccatggtc gtattggatt
     3121 ccatcgtata gtgatgatgc gagattcaat ctgtcgtatc ttctgaactt gtcaatatac
     3181 ggtgtaaact ggccatcagc atatctcatt ggcgatttct tcgtactcct cttggcatca
     3241 tgccaattag cagttttccg gcgagaagga gaagataatg attcaattta caatgatgga
     3301 aactttgtga ttaagccaga aaatccacaa tatgacttta ttgacaccaa aaagagttac
     3361 gttgattatt tcaaatcatt cgttttccat tatggacact ggattacatt gatgtctaca
     3421 ctagcagcag gaattgctgg aacgtcactt tttgctttgg gatacattat attcactctg
     3481 acaatgctgt ggtctggtaa caatttgtat gtgatgaact caactctacg atcatttgaa
     3541 catactttga aacgatggaa tgcacttttg ggatacacat tgttcacgat tacaatgaaa
     3601 gtttgccttc aaatatttgg atgtgtattc ctgtcgtggt tcgatcaatc tggtggatgg
     3661 ggaaagactc tgtgcatcgt tcgtcaactc ttcagtatca catgtgttaa taacgaatgt
     3721 catgtgctca aagagctgga ggatttctcg aaggcgtgtg ctgttgagac gaaagaagga
     3781 aatattggat ttgatgtgat tgcgctatcc ttcctcgtct tccaaatccg aattttccat
     3841 tcttggtatt tccaacactg catggttgaa tatcgaagtg aggttattct ggccaataga
     3901 ggtgccgtgc tgaagaatca actgattgaa aaggaaatga aggaacaaaa cgagcagcaa
     3961 aaagccaagt tcaatgatat cagaagaaga actgaagcta ttcgtgaaag atatcaaaaa
     4021 caaatcgaac gaggagctgc tgaacgtgac ttcgagccgg ttacttatgg gcacgccaaa
     4081 cgagcgggag actactacat gttcaaatac gatcctgaaa atgatgatct tgtggaaccc
     4141 gtcgacagtt ttgtaccaga agttgatccc aaggcaactg catatgatcg acttgatcct
     4201 ggacagataa tgtacgctgc caccgctcac gacctcgacc tcgccaaaac tgtacagcaa
     4261 gtcaagaaag gcgatactat caaagatcct gattcacgtg ctcttatcgc tgtttctgaa
     4321 ccagaagctc gtaagccagg aggcactgaa gaaacggatg gtgatgaaga tgaggataat
     4381 aaggattcga aagtggaaag tactgctaaa ttcattcaaa aaatgatcgc ttctgccttg
     4441 gacttgtgta gtgtaacact aaacaaactg tgcagagaac accgatatgt tggatttgtt
     4501 ttgagcaagg aaaaacaaaa gttgaagtca ggacactcgg aatctctttc aaatacatct
     4561 agaaagctga cggatattcg atctgcagtt gatctaccaa gtcttcaact tgtgcaatcg
     4621 gcgaatgatg ttgaaaagat ggagacagcc gtcagcgtgg attggcaaca aaaatcatca
     4681 gcaacgagac tattgaatgc agttgtgaat tgtattggag cacacactga tattctctgc
     4741 tacttcttcg caattatgac acaagtgatg actggtggac ttattactct tccacttcct
     4801 ctgatgtcac tattctgggg aaatctatcg aatcctcgtc catccaagtt cttctgggtc
     4861 acaatgatca cctacactga gtgtgtcatt gttatcaagt ttgtttgcca atttgcattc
     4921 atgccttaca attctatcac gtggcgaaca gagcatcaaa tggacccgat gtcattggat
     4981 aagttattcg gagtatcaca gagagatagt tttgcacttt gggacattgt tttgctcttc
     5041 tcactcttct tccatcggta tatgctcaga aagttagggt tatggaagga tgccaatttg
     5101 acggacacgt tcactttgaa ggaagagcct cgatcggcgt caggatcgga cacaggatca
     5161 cccaagaaaa ttgctcaaga gccaaaggtt gttgtaactc agtcagatac ccttgaaggt
     5221 acaagtggag gagagatagt cataccatct gatccaaatg cagtttccaa tatggaagaa
     5281 ttagactgcg aacctccgat tccagagaag caaagtggac caattggaag attcattcat
     5341 caattattcc atccaaaatt ccgttacatt cgtgatttgt atccaataat gtttggaatc
     5401 gatgtgatat gcttcctcat catgacattt ggatactcgg catttggtga aggaggttct
     5461 ggaaatgttt tagatgatgt gaaggcttct cgtattccgg taacacttgt tgttatgctc
     5521 gttggaatga ctctggcaat tatcattgat cgagcactct acctcagaaa atcagttgtc
     5581 ggaaagctaa tctatcaagt cttaatgatt gctttccttc acatttgggt attccttgtt
     5641 cttccaaata tgactcgtcg ttctgcgata tcgaatcacg ttgctcaagc attgtacgtc
     5701 atcaaatcgt gctatttcct tgtgtctgct tggcagatcc gaaatggtta tcctgaactt
     5761 tgtattggaa atctattaac acattcatac ggaatgacca atatgattgc attcaaagta
     5821 ttcatgaata ttccattcct cttcgagctt cgtacagcta ttgattggac atggacagat
     5881 acttcaatgc ctcttttcga tttcttcaat atggaaaatt tctatgctca tatattcaat
     5941 atcaagtgtg cccgccagtt cgaagctgcc tatccagctc caagagggat tcccaaagga
     6001 aagttggtca agtatatgat gggattccca attatcattg gagtcgttat cttcatcttt
     6061 tctcctctat tgctctggtc gctactcaat caaatcggaa ctatcagtat gccagaaaaa
     6121 gttacgttga ggatttcgat tgaaggatat ccaccacttt acgagatgga ggcacaagga
     6181 agtaatcacg ataacgctga acttggaatg ataaaacctg atcaattggc atctttgaat
     6241 caagcattga cggatagtta cacgacacga gacactaatt ctattttaag atcaagaatg
     6301 tctgtatcat atctgaaagg atacacatat gaggatattc tgattgtgcg attccgtcca
     6361 gaatctgaaa tttattggcc gatttcacag gattcgagaa atgcgatgat cgataaattg
     6421 agccgaaaca cgtcagtcaa ttttgaagta tctctggaat tcactcggcc atatgatcca
     6481 aatgaaaacg ctgctttaaa acattcgaaa tcgtggcttg ttccaatctc cctggatatg
     6541 acgattcgag caaaaattca aagtgctctc cgaggagatc caggtcatcc gattctcatt
     6601 ccacagtcaa ttcctgcgtt tattcaagtt ccaaatcaag gagaattgac ccttccaaca
     6661 tcaatcggaa atactattat caatgacgga aatccacgga ttaatacgac cgggatggaa
     6721 aaatcagacg aagctcgggc ttggttcgac tcgttaacct tgaatctcga acaaggaaaa
     6781 tcgcaaaacg agaaaatgtg gatcgccaca tccgaacatc caggagacca aaatgcgaaa
     6841 ctctggataa agactgcaaa tacgacgtat tcgggaaggc cgtaccttca agttgtcgga
     6901 tttattgata gagcattccc atcatttttg gcgaaagttt tcaaaggagg agtcattgca
     6961 gtgtatcttt cagttatcct cgtcgttgga agaggtctgg ttcgtggaat cttcaccaca
     7021 tctccaagca ctgtcatgtt cacagaatta ccgaatgcgg atcatcttct caaaatttgt
     7081 ctcgacatct atttggttcg agaagcgaag gacttcatgt tggagcagga tctcttcgcc
     7141 aaattaatat tcctgttccg atcaccagcg acactcatcg aatggacacg aatgagcaaa
     7201 aagaagcaag aataa
//