Dbfetch

LOCUS       NM_001307051            7329 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001307051
VERSION     NM_001307051.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 7329)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 7329)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7329)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 7329)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..7329
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>7329
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..7329
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1g"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001293980.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1g"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:A0A061ACU2"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:A0A061ACU2"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MTVPPLLKSCVVKLLLPAALLAAAIIRPSFLSIGYVLLALVSAV
                     LPPIRKSLALPKLVGTFVIITFLFCLAVALGVGSYQISEQVVHKNDRTYICNRSDTTL
                     FRSIGLVRFHPTGTFESTRAFLPEIIATSAALLTIIIVMFLSHRDEQLDVVGDVVTVR
                     SESGREQRRQRKLAAIMWSAIGNSLRRLTNFVLFLFTAYVGIVKPSLSNSIYFLAFLF
                     ISTWWSTYTPLRHGVYNQIKKFLIFYSALHFLVLYTYQIPIVHHSWLPTGSFLPRLFG
                     LTVLMDSSCPEWWKFPFVAPDFNDDDLIMKWPLYANPIVVLVFFYLTVAQYKFTRNGS
                     REYIDDNEYGSSVHEERFVSAGTVETNVDDVGQLISISESTASAPSGRGRGNTLLLSN
                     ASSSANDDEQGRARSRSPLRNGEEQGSIPLRKVTSQVVDRNKLSNIFNTTAPGDKESA
                     ASKGMIAVMTFVIFHSYSIALTAMMTWALLYHSIFGLILLILTCILWIFRDTRKSSFA
                     MAPIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGIEWTTLPVHAVIILCVQTLLT
                     LPVFLLLRLARREKFYESLSDYERQRRINSYGTFGASKTGAGGVAVAKFQDPKSRKFA
                     AFVEYLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILFFALWALNLIYLKFSFRLYRG
                     LAYAFWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSLSQEWLNAIGLVDFRAIGESG
                     ALFLQLLAPIALFVVTMLQLKFFHGPWSRATSPRRAENDPPTSTTEAAAVASTSGTQG
                     RAHAAGDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVIL
                     LSLAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPELSQIDRGVGADNCSHGNI
                     SMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKV
                     FPDFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVL
                     FALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFN
                     LSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREGEDNDSIYNDGNFVIKPEN
                     PQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSG
                     NNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTL
                     CIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSW
                     YFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQK
                     QIERGAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLVEPVDSFVPEVDPKATAYDRL
                     DPGQIMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALIAVSEPEARKPGGTEETDGDE
                     DEDNKDSKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSE
                     SLSNTSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCI
                     GAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVI
                     VIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYM
                     LRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEI
                     VIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVIC
                     FLIMTFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGK
                     LIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPEL
                     CIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHI
                     FNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTIS
                     MPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNS
                     ILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSL
                     EFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQV
                     PNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWI
                     ATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVI
                     LVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIF
                     LFRSPATLIEWTRMSKKKQE"
     STS             2693..3568
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             4591..5624
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgacggtcc cgccgctttt aaaatcgtgc gtcgtcaaat tgctgcttcc ggcagcactg
       61 cttgcagctg ccataatccg gccgagcttt ttatcaattg gctacgtcct acttgcactt
      121 gtcagcgccg ttctgccacc aattcgaaag tctttagcac ttcccaaact agttggaaca
      181 ttcgttatta tcacttttct cttctgccta gcagtcgcac taggagttgg ttcctaccag
      241 atctcagaac aagttgttca taaaaatgac cggacataca tttgcaatcg atccgacact
      301 actctgttcc ggagcattgg ccttgtccga ttccatccaa caggaacatt tgaatcaact
      361 cgagcatttc ttccggagat tattgccacg tctgcagctc tgctcactat cataatcgtc
      421 atgtttttgt cgcatagaga cgagcaattg gacgtcgttg gtgatgttgt aacagtcagg
      481 agtgaatctg gccgcgagca acgacgacaa agaaagttag ccgctataat gtggagtgca
      541 atcggaaatt ctctacgaag attgactaat ttcgtgcttt tcctgttcac ggcatatgtt
      601 ggaatcgtga aaccatcgct gagtaactca atttactttc tcgcttttct gttcatatcc
      661 acgtggtggt ccacatacac accactgaga catggagtgt acaatcagat aaagaagttt
      721 ctcatattct actcggcgct tcatttcttg gttctctaca catatcaaat tccgatcgtt
      781 caccactcat ggctgccgac cggttcattt ctgccacgtc tgttcggact tactgtactc
      841 atggattcat catgtcccga atggtggaag tttccatttg tagctccaga ctttaacgat
      901 gatgatttga ttatgaaatg gccgttgtat gcaaatccga ttgttgtact ggtgttcttc
      961 tacctcacag ttgctcaata caaattcacg agaaacggat ctcgtgaata tatcgatgat
     1021 aacgaatatg ggtcatcagt tcacgaagaa cgttttgtct ccgccggcac tgtcgaaacg
     1081 aatgtggacg acgtgggtca gctcatttca atttctgaga gcacagcttc tgctccatct
     1141 ggcagaggac gtggaaatac tttgcttctg tccaatgcat cctcctctgc taatgatgat
     1201 gaacagggtc gagctcgttc gcgatctccg ctgcgaaatg gtgaagaaca aggctcaatc
     1261 ccactacgga aagttacttc gcaagttgtt gataggaata agttgagcaa catttttaat
     1321 actacagcac ccggagataa ggaatctgct gcttcgaaag gaatgattgc agtcatgaca
     1381 tttgtcattt tccattcgta ttcaatcgcg ctgactgcta tgatgacatg ggctctcctc
     1441 tatcattcga tattcggtct cattctcctc atcctcacat gtatcttgtg gatcttccgt
     1501 gatacgagaa agtcatcgtt tgcaatggcc cctattattt tgatgtatat cgagtttcta
     1561 ttgattcttc aatatttcct cagtatggat attcatgcag aaattggcga tccagcgtgg
     1621 atgaactttg ttggaatcga atggactact cttccagtac atgctgtcat cattctctgt
     1681 gtccagactc ttctcactct cccagtgttc ttgcttctac gtttggctcg cagggagaag
     1741 ttttacgaat cgctgagtga ttatgaacga caacgacgaa tcaactcata tggaacattt
     1801 ggagcatcaa agactggagc tgggggtgtt gcagtggcta agtttcagga tccaaaaagt
     1861 cggaagttcg cggcatttgt ggaatatctg tcgaataaag tgtctgtcta cttcatattt
     1921 gtagtatcag tggtactttt ggtggtctct acgtgttttg ctccgaattt ctacaatatt
     1981 ctattcttcg cactatgggc attgaacttg atttatctca agttctcatt ccgtctgtat
     2041 cgtggattgg catatgcatt ctggctaact ctcacgttct acacttcaat tgttattatc
     2101 gccctctaca tttatcagtt ccctggagta tctcaatgga ttattcgaaa tactagtttg
     2161 tcgcaggagt ggctgaatgc aattggactt gtcgatttta gagctatcgg tgaatcggga
     2221 gccctatttc tacaattact cgccccaatt gccttgttcg tcgtcacaat gctccaactc
     2281 aagtttttcc atggaccatg gagtcgagca acgtcaccaa gaagagcaga aaatgatcca
     2341 cctacaagta cgacggaggc tgcggcggta gcaagcacat ctggaacaca aggaagagca
     2401 catgctgcag gcgataccct tgtcaagaag ctgcacaaat tggcaaatca gacaatcgaa
     2461 ctgttatgga ggtttttcga agttcacatt tcgaaaattg tctttgtcat cattgcgatt
     2521 tttattgcca acaatatcaa tgctctatac attccacttg ttattctcct ctcattggct
     2581 atatgtctac catcagctgc agatgggata ttctctttat ttatgtgtgc ctacttattc
     2641 ctcgtggcac tgagcaagat gatctaccaa ctggatattg ttcccgagtt atcacaaatc
     2701 gaccgaggag ttggagcaga taactgttca catggaaata tttcaatgcc tgaatggttt
     2761 ggattgaaga aggaagttga aggaactgaa ccaatttata tgctctttgg agtcattgtt
     2821 tcgattattg cattggcttt tcaatcaatt gttatatatc gacaaagaca ttatcgagct
     2881 tcactgggac ttcctgaatc gatgcgagct aaagtgttcc cggacttcca tcattctcat
     2941 tttgatagat ctctcaaaaa tgccatccaa ttcttgatag actatggttt ctataagttt
     3001 ggacttgaaa tcacgatgat cgccattgga attgacattt tcaatcgaat ggatgcattg
     3061 gcagcgattc aatgtttctg gcttgtcctg tttgcgctca ataaaagagt ctttgttcga
     3121 agaatatggg tattctatgt gatctatatg gcgattctgt atccacttca gttcttttca
     3181 tatgttggat taccacctga cagttgtatt gagtatccat ggtcgtattg gattccatcg
     3241 tatagtgatg atgcgagatt caatctgtcg tatcttctga acttgtcaat atacggtgta
     3301 aactggccat cagcatatct cattggcgat ttcttcgtac tcctcttggc atcatgccaa
     3361 ttagcagttt tccggcgaga aggagaagat aatgattcaa tttacaatga tggaaacttt
     3421 gtgattaagc cagaaaatcc acaatatgac tttattgaca ccaaaaagag ttacgttgat
     3481 tatttcaaat cattcgtttt ccattatgga cactggatta cattgatgtc tacactagca
     3541 gcaggaattg ctggaacgtc actttttgct ttgggataca ttatattcac tctgacaatg
     3601 ctgtggtctg gtaacaattt gtatgtgatg aactcaactc tacgatcatt tgaacatact
     3661 ttgaaacgat ggaatgcact tttgggatac acattgttca cgattacaat gaaagtttgc
     3721 cttcaaatat ttggatgtgt attcctgtcg tggttcgatc aatctggtgg atggggaaag
     3781 actctgtgca tcgttcgtca actcttcagt atcacatgtg ttaataacga atgtcatgtg
     3841 ctcaaagagc tggaggattt ctcgaaggcg tgtgctgttg agacgaaaga aggaaatatt
     3901 ggatttgatg tgattgcgct atccttcctc gtcttccaaa tccgaatttt ccattcttgg
     3961 tatttccaac actgcatggt tgaatatcga agtgaggtta ttctggccaa tagaggtgcc
     4021 gtgctgaaga atcaactgat tgaaaaggaa atgaaggaac aaaacgagca gcaaaaagcc
     4081 aagttcaatg atatcagaag aagaactgaa gctattcgtg aaagatatca aaaacaaatc
     4141 gaacgaggag ctgctgaacg tgacttcgag ccggttactt atgggcacgc caaacgagcg
     4201 ggagactact acatgttcaa atacgatcct gaaaatgatg atcttgtgga acccgtcgac
     4261 agttttgtac cagaagttga tcccaaggca actgcatatg atcgacttga tcctggacag
     4321 ataatgtacg ctgccaccgc tcacgacctc gacctcgcca aaactgtaca gcaagtcaag
     4381 aaaggcgata ctatcaaaga tcctgattca cgtgctctta tcgctgtttc tgaaccagaa
     4441 gctcgtaagc caggaggcac tgaagaaacg gatggtgatg aagatgagga taataaggat
     4501 tcgaaagtgg aaagtactgc taaattcatt caaaaaatga tcgcttctgc cttggacttg
     4561 tgtagtgtaa cactaaacaa actgtgcaga gaacaccgat atgttggatt tgttttgagc
     4621 aaggaaaaac aaaagttgaa gtcaggacac tcggaatctc tttcaaatac atctagaaag
     4681 ctgacggata ttcgatctgc agttgatcta ccaagtcttc aacttgtgca atcggcgaat
     4741 gatgttgaaa agatggagac agccgtcagc gtggattggc aacaaaaatc atcagcaacg
     4801 agactattga atgcagttgt gaattgtatt ggagcacaca ctgatattct ctgctacttc
     4861 ttcgcaatta tgacacaagt gatgactggt ggacttatta ctcttccact tcctctgatg
     4921 tcactattct ggggaaatct atcgaatcct cgtccatcca agttcttctg ggtcacaatg
     4981 atcacctaca ctgagtgtgt cattgttatc aagtttgttt gccaatttgc attcatgcct
     5041 tacaattcta tcacgtggcg aacagagcat caaatggacc cgatgtcatt ggataagtta
     5101 ttcggagtat cacagagaga tagttttgca ctttgggaca ttgttttgct cttctcactc
     5161 ttcttccatc ggtatatgct cagaaagtta gggttatgga aggatgccaa tttgacggac
     5221 acgttcactt tgaaggaaga gcctcgatcg gcgtcaggat cggacacagg atcacccaag
     5281 aaaattgctc aagagccaaa ggttgttgta actcagtcag atacccttga aggtacaagt
     5341 ggaggagaga tagtcatacc atctgatcca aatgcagttt ccaatatgga agaattagac
     5401 tgcgaacctc cgattccaga gaagcaaagt ggaccaattg gaagattcat tcatcaatta
     5461 ttccatccaa aattccgtta cattcgtgat ttgtatccaa taatgtttgg aatcgatgtg
     5521 atatgcttcc tcatcatgac atttggatac tcggcatttg gtgaaggagg ttctggaaat
     5581 gttttagatg atgtgaaggc ttctcgtatt ccggtaacac ttgttgttat gctcgttgga
     5641 atgactctgg caattatcat tgatcgagca ctctacctca gaaaatcagt tgtcggaaag
     5701 ctaatctatc aagtcttaat gattgctttc cttcacattt gggtattcct tgttcttcca
     5761 aatatgactc gtcgttctgc gatatcgaat cacgttgctc aagcattgta cgtcatcaaa
     5821 tcgtgctatt tccttgtgtc tgcttggcag atccgaaatg gttatcctga actttgtatt
     5881 ggaaatctat taacacattc atacggaatg accaatatga ttgcattcaa agtattcatg
     5941 aatattccat tcctcttcga gcttcgtaca gctattgatt ggacatggac agatacttca
     6001 atgcctcttt tcgatttctt caatatggaa aatttctatg ctcatatatt caatatcaag
     6061 tgtgcccgcc agttcgaagc tgcctatcca gctccaagag ggattcccaa aggaaagttg
     6121 gtcaagtata tgatgggatt cccaattatc attggagtcg ttatcttcat cttttctcct
     6181 ctattgctct ggtcgctact caatcaaatc ggaactatca gtatgccaga aaaagttacg
     6241 ttgaggattt cgattgaagg atatccacca ctttacgaga tggaggcaca aggaagtaat
     6301 cacgataacg ctgaacttgg aatgataaaa cctgatcaat tggcatcttt gaatcaagca
     6361 ttgacggata gttacacgac acgagacact aattctattt taagatcaag aatgtctgta
     6421 tcatatctga aaggatacac atatgaggat attctgattg tgcgattccg tccagaatct
     6481 gaaatttatt ggccgatttc acaggattcg agaaatgcga tgatcgataa attgagccga
     6541 aacacgtcag tcaattttga agtatctctg gaattcactc ggccatatga tccaaatgaa
     6601 aacgctgctt taaaacattc gaaatcgtgg cttgttccaa tctccctgga tatgacgatt
     6661 cgagcaaaaa ttcaaagtgc tctccgagga gatccaggtc atccgattct cattccacag
     6721 tcaattcctg cgtttattca agttccaaat caaggagaat tgacccttcc aacatcaatc
     6781 ggaaatacta ttatcaatga cggaaatcca cggattaata cgaccgggat ggaaaaatca
     6841 gacgaagctc gggcttggtt cgactcgtta accttgaatc tcgaacaagg aaaatcgcaa
     6901 aacgagaaaa tgtggatcgc cacatccgaa catccaggag accaaaatgc gaaactctgg
     6961 ataaagactg caaatacgac gtattcggga aggccgtacc ttcaagttgt cggatttatt
     7021 gatagagcat tcccatcatt tttggcgaaa gttttcaaag gaggagtcat tgcagtgtat
     7081 ctttcagtta tcctcgtcgt tggaagaggt ctggttcgtg gaatcttcac cacatctcca
     7141 agcactgtca tgttcacaga attaccgaat gcggatcatc ttctcaaaat ttgtctcgac
     7201 atctatttgg ttcgagaagc gaaggacttc atgttggagc aggatctctt cgccaaatta
     7261 atattcctgt tccgatcacc agcgacactc atcgaatgga cacgaatgag caaaaagaag
     7321 caagaataa
//