Dbfetch

LOCUS       NM_001306974            5035 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Calcium-dependent secretion activator
            (unc-31), mRNA.
ACCESSION   NM_001306974
VERSION     NM_001306974.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5035)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5035)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5035)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5035)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Sep 4, 2019 this sequence version replaced NM_001306974.1.
FEATURES             Location/Qualifiers
     source          1..5035
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            1..5035
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /db_xref="GeneID:178233"
                     /db_xref="WormBase:WBGene00006767"
     CDS             20..4204
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /standard_name="ZK897.1l"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Calcium-dependent secretion activator"
                     /protein_id="NP_001293903.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006767"
                     /db_xref="EnsemblGenomes-Tr:ZK897.1l"
                     /db_xref="GeneID:178233"
                     /db_xref="GOA:A0A061ADT8"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR010439"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR014770"
                     /db_xref="InterPro:IPR033227"
                     /db_xref="InterPro:IPR035892"
                     /db_xref="UniProtKB/TrEMBL:A0A061ADT8"
                     /db_xref="WormBase:WBGene00006767"
                     /translation="MLGASSSEEEDDDFQEDHDSLPIAQVKKRSLLSGAMTPRSSSPA
                     PSDSVSQTNSLKRNNSSSQGRRKDSVQSQTPARSPMRMNAPSPMPQARIMSNVSKPIM
                     QNSQEFDGDEEEGEEGSTTVVGSGDECGGPALSKEEQERMKAEREEEDHKKNLQMYMF
                     LARCIAYPFNGQQTGDMARRQMKVNKQELARIRERFTLFLKGETNIAADEAFTKAIQS
                     YFEVFLKSERVQKVVHAGGFSQHDFREVFRLNIEKRVRSLPDIEGLSKDTVLNSWLAK
                     FDAIIKGDETDQNRNARGRSRNPQNAMSADAVLGKEQLYDVFQQILGVKKFEHQIIFN
                     ALQLDNPDEQAAAIRREFATREEALKDPIKMKRLTPKFVVKDMETLYMDEVRMSINTL
                     IGNLETVPVTTRGATVGKRKDKSRSRSIEDLSLFNSLKRRTSSGSLNKGDSEDGDVTL
                     TKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTMEVDGHKLQTDHAEASKPKWDTQGD
                     FSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQPTPNCARSPEWYTMTLPKSSQDQ
                     NLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRFFCLVQVSQYAFAVCSFRQKKA
                     DPTEFIQLDGFTIDYMPESDPELSAQGGKHFFTAIKEGDELKFATDDENERHLWVQAL
                     YRATGQAYKPVPPKQSTIAPKAQGFQDKASKHGMDAMIQADSINFDHDHFYSDVQRLT
                     LDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCFRHVTLLSNLLDKADDGLLIDPA
                     LIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEKFQEIKERLRVLLEKQITNFR
                     YCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVIRKCLEDAALVNYTRICNE
                     AKIEQRMGIDVSPAQRIEDMIRVTEFCIDLLKENEEHHGEQLRGAFAWFSDLLSDHSE
                     IFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIFHNKIVQQFQPLV
                     VRYIDLMEHSIAQAIDKGFSKEKWESRKEGCATSEDIYWKLDALHTFVIDLNWPEEDF
                     RKYLQTKMKSLTSDMISKVSDCTFTAFDSWMQRAKKSTDYMLPSEVCVQINVMFSSKS
                     RAVRVTVDSGEYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYDEGNPIG
                     AILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQIGNSYVTFFHGCTEL
                     LRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQDFS
                     LQGIDEERLNSKTYQSISRRLQLEESNSHIQEAAINGSAQGSVFPTSLGNATAAVSNM
                     SSMVEGAGAKMFSLFK"
ORIGIN      
        1 agtcttcgtt tggaacatca tgttaggagc aagtagtagt gaagaagaag acgacgattt
       61 tcaggaggat catgattcgc taccaattgc acaggtcaaa aagcgatcac tgctctccgg
      121 ggcgatgaca ccaaggagca gctcaccggc tccgtcggac tcggtttcac agacaaattc
      181 gttgaaaaga aacaattcga gttcacaggg aagaaggaaa gattcagtgc aaagtcagac
      241 acctgctaga tcgccaatga gaatgaatgc tccatcacca atgccacagg cgagaataat
      301 gtcgaatgtt tcaaagccga taatgcaaaa ttcacaagaa ttcgatggag atgaggaaga
      361 aggggaagaa ggttcaacta cagtagtcgg tagtggagat gaatgtggtg gtcctgcttt
      421 gagcaaagaa gagcaggaaa gaatgaaagc cgaacgagag gaagaagatc ataagaagaa
      481 tcttcaaatg tacatgtttc tagccagatg catagcatat ccattcaatg gacagcagac
      541 tggtgacatg gctcgtcgac aaatgaaagt gaataaacag gaattggcta gaattcgaga
      601 acgattcact ctttttctta aaggagaaac aaatattgct gctgatgaag cattcactaa
      661 agcgattcaa agttatttcg aagtatttct gaaatctgaa agagttcaga aagttgttca
      721 cgccggcgga ttttcacaac atgattttcg agaagttttt cgattaaata ttgagaaaag
      781 ggttcgaagt cttcctgata ttgaaggatt atcaaaggat actgtattga attcttggtt
      841 agcaaaattc gatgcaatta ttaaaggaga tgagactgat cagaatagga atgctcgagg
      901 ccgctctcga aatccgcaga atgcgatgag cgctgacgca gtactaggca aagagcaact
      961 ctacgacgtt tttcaacaaa ttcttggtgt gaagaaattc gagcatcaaa tcatattcaa
     1021 cgcacttcag ttggataatc cagatgagca ggcggcagca atccggagag agtttgcgac
     1081 aagagaagaa gctttgaagg atcctatcaa gatgaagcgt cttactccaa aatttgtggt
     1141 aaaagacatg gaaaccctgt acatggacga agttcgaatg tcgataaaca ctttaatagg
     1201 aaatttggaa acagttccag tgacaacacg aggggcaact gtcggaaaac gaaaagacaa
     1261 gagtcgatcc cgcagtatag aggatttgtc gctcttcaac agccttaaac gaaggacaag
     1321 ctccgggagt ctcaacaaag gagatagtga agatggtgac gtcacactga caaagtctga
     1381 tgtctcattg gctttgagta tggaggttgt cgtgatggaa gtgcagggtc taaaatccgt
     1441 gcaacccagt aaaatagtgt attgcacgat ggaagtagac ggtcacaagc tgcagacaga
     1501 tcatgcggag gcttccaaac caaaatggga tacacaagga gacttttcga cgaaaaatcc
     1561 attgcccgtg gtgaaagtga aattgtatac agaagtgaag agtatgatag catttgagga
     1621 taaagaatta ggaaaagtaa taatccagcc gacgccaaac tgtgcgcgaa gtccagaatg
     1681 gtacaccatg acattaccaa aaagtagtca ggatcagaat ttaaagatta ggatagcaat
     1741 tcgagtagaa aaaccgccga atttaaagta ttgcggttat tgttattgta tcgggcgaaa
     1801 cgcgtggaag aagtggaaga agcgattctt ttgtcttgtt caagtatctc agtacgcatt
     1861 tgctgtatgt agttttcgac aaaagaaggc cgatcccacg gaattcattc aattagacgg
     1921 gtttacgatc gattatatgc cggagtcgga tccagaactc tctgcgcaag gaggaaaaca
     1981 cttcttcact gccatcaaag aaggagacga gctgaaattt gcgactgatg acgaaaatga
     2041 gcgacatcta tgggtccagg ctctgtaccg agccacaggt caagcctata aacctgtgcc
     2101 tccaaagcag tcaacaattg ctccaaaggc tcaaggtttc caggataaag ccagcaaaca
     2161 tggaatggat gcaatgattc aggctgattc gattaatttc gatcatgacc atttttattc
     2221 cgatgttcaa cgattaactc tggattttcg gatcaacgag ccgatttgtt cattgggttg
     2281 gttctcacct ggtcaagcat ttgttctgga agaatactct gctcgatata tggttcgtgg
     2341 atgcttccgc cacgtaaccc tcttatcaaa tcttttggat aaagctgacg atggattgct
     2401 cattgatcca gctctaattc attactcttt cgctttttgt gcatctcatg tccatggaaa
     2461 taggtgtatg cctgatcgac aaggacctga aggagttggt acagtaactc tggaggagaa
     2521 ggaaaagttc caggaaatca aggaacgatt gagagtactt ctagagaagc aaatcacgaa
     2581 tttccgttat tgtttcccat ttggaagacc tgaaggcgca cttaaaggga cattaggtct
     2641 attggaaaga gttttgatga aggatgttgt gtcgccagtt ccaccggaag aagttcgagc
     2701 agttattaga aaatgtttgg aggatgctgc attggttaat tacacaagga tttgcaatga
     2761 agcaaagatt gaacaacgaa tgggtattga tgttagtccg gctcaacgaa tcgaggacat
     2821 gatccgcgtg acggaattct gcattgatct gctcaaggag aacgaggagc atcatggaga
     2881 gcaacttcga ggggctttcg cgtggttttc cgaccttctt tccgaccatt ccgagatctt
     2941 ttggtcattg tattcagtcg acttggactc ggcactggaa gttcaaccac acgatagttg
     3001 ggattctttc cctcttttcc agatgctcaa cgactttttg ctgtctgaat caagcctgaa
     3061 aggaggtata ttccacaaca aaatcgttca acaattccaa cctctcgttg tacgatacat
     3121 tgacctcatg gagcactcga ttgctcaggc gattgacaaa ggattttcca aggaaaaatg
     3181 ggaatcaaga aaagaaggat gtgcaacttc ggaagatatt tactggaagc tcgacgctct
     3241 tcacacattt gtcatcgatc tgaactggcc tgaagaggat ttcagaaaat atttgcagac
     3301 gaaaatgaaa agtctaactt ctgatatgat atccaaggtt tccgattgca ccttcaccgc
     3361 attcgacagt tggatgcaac gagccaaaaa gtccaccgat tacatgcttc catcagaagt
     3421 ttgcgtgcaa atcaacgtaa tgttcagctc aaagagccgt gctgttcgag tcactgttga
     3481 ttctggagaa tacaaatatc agtcaaaact cgacgaaact ctggagacaa tgctcaaaac
     3541 tatggaatca tgtattcaag agaaacttca cggagttctt gaatcagtgc tctcacgtct
     3601 tgctcgatac gacgagggaa atccgattgg agcaattttg aatattgccc caaagcctgc
     3661 atcgattttc aacaaattga agacaatggc cggagacacc tcggctcagg caacgacgac
     3721 agcgcgtcaa cctctgactg ctcaacaatc atcagggcaa atcggaaatt catatgttac
     3781 atttttccac ggatgcactg aacttcttcg acaagttatt atcgatgaaa tttgggttaa
     3841 tgggctcttc gagcattggt acgacaacca aatgaaatca atcaatgaat ggttgacaga
     3901 acgtcttcaa caatcgttga gtgcaactca atacatttcc ctttcgacaa ttgtaaaaaa
     3961 agtgtatcaa gacttttcac tgcaaggaat cgatgaagaa cgactgaata gtaagactta
     4021 tcagtcaatc agtcgacgat tacagcttga agagtcaaat tctcatattc aagaagccgc
     4081 catcaatgga tcagctcaag gttcggtgtt tcccacgtcg ttggggaacg cgacagcagc
     4141 cgtatccaac atgtcaagta tggtcgaagg agccggtgca aagatgttct cgctttttaa
     4201 atagattttt tctaatattt ttctttaagc ggtgttttct cacgggattt atttgaaata
     4261 gaccatttcg aacagaaatg ccaagaagtg ggaggagatt aaggctcctc ccagttcttg
     4321 gtgattagta aacagagtcg tgccctcaga ataatgccgt ttttatttta aagttatagt
     4381 ttcatatttt tataattatt caaatttaaa aacgctttca attatacgag tttcatttag
     4441 tttatggaaa gatttttaat cgaccgtatt ttctcaactt tgccagctca tatctcagct
     4501 atctttggtt gtattaaaac aatttcaact ggaaacgtgt tccttattta tttttctata
     4561 aatgcatagt ttaaaattgt ttgatatctc caacatgagc cgagatatta gtcaccaaat
     4621 tagaggagat acgaaacttt tttttttaat tcaaacttct atcgcttcta cgtttagctt
     4681 ttttcttcaa atttttttaa aattttaatc tggtgaatca aagatcaaat gttaatttcc
     4741 ctttgcgtct ttcgtctcat tttttgtcac caaaagacct ctttcgcctc ccagttgttc
     4801 caattttgtc ccccgtttcc acgcccactc aattttaccg gtaattattt ttttttctcg
     4861 gcagaatttt aactgtaata gctttaattt attttattat atcatttgca aatttcactt
     4921 ataatcagct tttcattgtc tttggagctt tttttgaagc tctcccctca aaatacttgt
     4981 accctttttg gtggtcctaa tttattacag attttattat tttatatgaa gcttt
//