Dbfetch

LOCUS       NM_001306973            5044 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Calcium-dependent secretion activator
            (unc-31), mRNA.
ACCESSION   NM_001306973
VERSION     NM_001306973.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5044)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5044)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5044)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5044)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Sep 4, 2019 this sequence version replaced NM_001306973.1.
FEATURES             Location/Qualifiers
     source          1..5044
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            1..5044
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /db_xref="GeneID:178233"
                     /db_xref="WormBase:WBGene00006767"
     CDS             20..4213
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /standard_name="ZK897.1k"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Calcium-dependent secretion activator"
                     /protein_id="NP_001293902.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006767"
                     /db_xref="EnsemblGenomes-Tr:ZK897.1k"
                     /db_xref="GeneID:178233"
                     /db_xref="GOA:A0A061ACM4"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR010439"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR014770"
                     /db_xref="InterPro:IPR033227"
                     /db_xref="InterPro:IPR035892"
                     /db_xref="UniProtKB/TrEMBL:A0A061ACM4"
                     /db_xref="WormBase:WBGene00006767"
                     /translation="MLGASSSEEEDDDFQEDHDSLPIAQVKKRSLLSGAMTPRSSSPA
                     PSDSVSQTNSLKRNNSSSQGRRKDSVQSQTPARSPMRMNAPSPMPQARIMSNVSKPIM
                     QNSQEFDGDEEEGEEGSTTVVGSGDECGGPALSKEEQERMKAEREEEDHKKNLQMYMF
                     LARCIAYPFNGQQTGDMARRQMKVNKQELARIRERFTLFLKGETNIAADEAFTKAIQS
                     YFEVFLKSERVQKVVHAGGFSQHDFREVFRLNIEKRVRSLPDIEGLSKDTVLNSWLAK
                     FDAIIKGDETDQNRNARGRSRNPQNAMSADAVLGKEQLYDVFQQILGVKKFEHQIIFN
                     ALQLDNPDEQAAAIRREFATREEALKDPIKMKRLTPKFVVKDMETLYMDEVRMSINTL
                     IGNLETVPVTTRGATVGKRKDKSRNQTKNKRSRSIEDLSLFNSLKRRTSSGSLNKGDS
                     EDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTMEVDGHKLQTDHAEASKP
                     KWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQPTPNCARSPEWYTMTL
                     PKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRFFCLVQVSQYAFAVC
                     SFRQKKADPTEFIQLDGFTIDYMPESDPELSAQGGKHFFTAIKEGDELKFATDDENER
                     HLWVQALYRATGQAYKPVPPKQSTIAPKAQGFQDKASKHGMDAMIQADSINFDHDHFY
                     SDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCFRHVTLLSNLLDKADD
                     GLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEKFQEIKERLRVLLE
                     KQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVIRKCLEDAALVN
                     YTRICNEAKIEQRMGIDVSPAQRIEDMIRVTEFCIDLLKENEEHHGEAFAWFSDLLSD
                     HSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIFHNKIVQQFQ
                     PLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCATSEDIYWKLDALHTFVIDLNWPE
                     EDFRKYLQTKMKSLTSDMISKVSDCTFTAFDSWMQRAKKSTDYMLPSEVCVQINVMFS
                     SKSRAVRVTVDSGEYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYDEGN
                     PIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQIGNSYVTFFHGC
                     TELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQ
                     DFSLQGIDEERLNSKTYQSISRRLQLEESNSHIQEAAINGSAQGSVFPTSLGNATAAV
                     SNMSSMVEGAGAKMFSLFK"
ORIGIN      
        1 agtcttcgtt tggaacatca tgttaggagc aagtagtagt gaagaagaag acgacgattt
       61 tcaggaggat catgattcgc taccaattgc acaggtcaaa aagcgatcac tgctctccgg
      121 ggcgatgaca ccaaggagca gctcaccggc tccgtcggac tcggtttcac agacaaattc
      181 gttgaaaaga aacaattcga gttcacaggg aagaaggaaa gattcagtgc aaagtcagac
      241 acctgctaga tcgccaatga gaatgaatgc tccatcacca atgccacagg cgagaataat
      301 gtcgaatgtt tcaaagccga taatgcaaaa ttcacaagaa ttcgatggag atgaggaaga
      361 aggggaagaa ggttcaacta cagtagtcgg tagtggagat gaatgtggtg gtcctgcttt
      421 gagcaaagaa gagcaggaaa gaatgaaagc cgaacgagag gaagaagatc ataagaagaa
      481 tcttcaaatg tacatgtttc tagccagatg catagcatat ccattcaatg gacagcagac
      541 tggtgacatg gctcgtcgac aaatgaaagt gaataaacag gaattggcta gaattcgaga
      601 acgattcact ctttttctta aaggagaaac aaatattgct gctgatgaag cattcactaa
      661 agcgattcaa agttatttcg aagtatttct gaaatctgaa agagttcaga aagttgttca
      721 cgccggcgga ttttcacaac atgattttcg agaagttttt cgattaaata ttgagaaaag
      781 ggttcgaagt cttcctgata ttgaaggatt atcaaaggat actgtattga attcttggtt
      841 agcaaaattc gatgcaatta ttaaaggaga tgagactgat cagaatagga atgctcgagg
      901 ccgctctcga aatccgcaga atgcgatgag cgctgacgca gtactaggca aagagcaact
      961 ctacgacgtt tttcaacaaa ttcttggtgt gaagaaattc gagcatcaaa tcatattcaa
     1021 cgcacttcag ttggataatc cagatgagca ggcggcagca atccggagag agtttgcgac
     1081 aagagaagaa gctttgaagg atcctatcaa gatgaagcgt cttactccaa aatttgtggt
     1141 aaaagacatg gaaaccctgt acatggacga agttcgaatg tcgataaaca ctttaatagg
     1201 aaatttggaa acagttccag tgacaacacg aggggcaact gtcggaaaac gaaaagacaa
     1261 gagtcgcaac caaaccaaaa acaaacgatc ccgcagtata gaggatttgt cgctcttcaa
     1321 cagccttaaa cgaaggacaa gctccgggag tctcaacaaa ggagatagtg aagatggtga
     1381 cgtcacactg acaaagtctg atgtctcatt ggctttgagt atggaggttg tcgtgatgga
     1441 agtgcagggt ctaaaatccg tgcaacccag taaaatagtg tattgcacga tggaagtaga
     1501 cggtcacaag ctgcagacag atcatgcgga ggcttccaaa ccaaaatggg atacacaagg
     1561 agacttttcg acgaaaaatc cattgcccgt ggtgaaagtg aaattgtata cagaagtgaa
     1621 gagtatgata gcatttgagg ataaagaatt aggaaaagta ataatccagc cgacgccaaa
     1681 ctgtgcgcga agtccagaat ggtacaccat gacattacca aaaagtagtc aggatcagaa
     1741 tttaaagatt aggatagcaa ttcgagtaga aaaaccgccg aatttaaagt attgcggtta
     1801 ttgttattgt atcgggcgaa acgcgtggaa gaagtggaag aagcgattct tttgtcttgt
     1861 tcaagtatct cagtacgcat ttgctgtatg tagttttcga caaaagaagg ccgatcccac
     1921 ggaattcatt caattagacg ggtttacgat cgattatatg ccggagtcgg atccagaact
     1981 ctctgcgcaa ggaggaaaac acttcttcac tgccatcaaa gaaggagacg agctgaaatt
     2041 tgcgactgat gacgaaaatg agcgacatct atgggtccag gctctgtacc gagccacagg
     2101 tcaagcctat aaacctgtgc ctccaaagca gtcaacaatt gctccaaagg ctcaaggttt
     2161 ccaggataaa gccagcaaac atggaatgga tgcaatgatt caggctgatt cgattaattt
     2221 cgatcatgac catttttatt ccgatgttca acgattaact ctggattttc ggatcaacga
     2281 gccgatttgt tcattgggtt ggttctcacc tggtcaagca tttgttctgg aagaatactc
     2341 tgctcgatat atggttcgtg gatgcttccg ccacgtaacc ctcttatcaa atcttttgga
     2401 taaagctgac gatggattgc tcattgatcc agctctaatt cattactctt tcgctttttg
     2461 tgcatctcat gtccatggaa ataggtgtat gcctgatcga caaggacctg aaggagttgg
     2521 tacagtaact ctggaggaga aggaaaagtt ccaggaaatc aaggaacgat tgagagtact
     2581 tctagagaag caaatcacga atttccgtta ttgtttccca tttggaagac ctgaaggcgc
     2641 acttaaaggg acattaggtc tattggaaag agttttgatg aaggatgttg tgtcgccagt
     2701 tccaccggaa gaagttcgag cagttattag aaaatgtttg gaggatgctg cattggttaa
     2761 ttacacaagg atttgcaatg aagcaaagat tgaacaacga atgggtattg atgttagtcc
     2821 ggctcaacga atcgaggaca tgatccgcgt gacggaattc tgcattgatc tgctcaagga
     2881 gaacgaggag catcatggag aggctttcgc gtggttttcc gaccttcttt ccgaccattc
     2941 cgagatcttt tggtcattgt attcagtcga cttggactcg gcactggaag ttcaaccaca
     3001 cgatagttgg gattctttcc ctcttttcca gatgctcaac gactttttgc tgtctgaatc
     3061 aagcctgaaa ggaggtatat tccacaacaa aatcgttcaa caattccaac ctctcgttgt
     3121 acgatacatt gacctcatgg agcactcgat tgctcaggcg attgacaaag gattttccaa
     3181 ggaaaaatgg gaatcaagaa aagaaggatg tgcaacttcg gaagatattt actggaagct
     3241 cgacgctctt cacacatttg tcatcgatct gaactggcct gaagaggatt tcagaaaata
     3301 tttgcagacg aaaatgaaaa gtctaacttc tgatatgata tccaaggttt ccgattgcac
     3361 cttcaccgca ttcgacagtt ggatgcaacg agccaaaaag tccaccgatt acatgcttcc
     3421 atcagaagtt tgcgtgcaaa tcaacgtaat gttcagctca aagagccgtg ctgttcgagt
     3481 cactgttgat tctggagaat acaaatatca gtcaaaactc gacgaaactc tggagacaat
     3541 gctcaaaact atggaatcat gtattcaaga gaaacttcac ggagttcttg aatcagtgct
     3601 ctcacgtctt gctcgatacg acgagggaaa tccgattgga gcaattttga atattgcccc
     3661 aaagcctgca tcgattttca acaaattgaa gacaatggcc ggagacacct cggctcaggc
     3721 aacgacgaca gcgcgtcaac ctctgactgc tcaacaatca tcagggcaaa tcggaaattc
     3781 atatgttaca tttttccacg gatgcactga acttcttcga caagttatta tcgatgaaat
     3841 ttgggttaat gggctcttcg agcattggta cgacaaccaa atgaaatcaa tcaatgaatg
     3901 gttgacagaa cgtcttcaac aatcgttgag tgcaactcaa tacatttccc tttcgacaat
     3961 tgtaaaaaaa gtgtatcaag acttttcact gcaaggaatc gatgaagaac gactgaatag
     4021 taagacttat cagtcaatca gtcgacgatt acagcttgaa gagtcaaatt ctcatattca
     4081 agaagccgcc atcaatggat cagctcaagg ttcggtgttt cccacgtcgt tggggaacgc
     4141 gacagcagcc gtatccaaca tgtcaagtat ggtcgaagga gccggtgcaa agatgttctc
     4201 gctttttaaa tagatttttt ctaatatttt tctttaagcg gtgttttctc acgggattta
     4261 tttgaaatag accatttcga acagaaatgc caagaagtgg gaggagatta aggctcctcc
     4321 cagttcttgg tgattagtaa acagagtcgt gccctcagaa taatgccgtt tttattttaa
     4381 agttatagtt tcatattttt ataattattc aaatttaaaa acgctttcaa ttatacgagt
     4441 ttcatttagt ttatggaaag atttttaatc gaccgtattt tctcaacttt gccagctcat
     4501 atctcagcta tctttggttg tattaaaaca atttcaactg gaaacgtgtt ccttatttat
     4561 ttttctataa atgcatagtt taaaattgtt tgatatctcc aacatgagcc gagatattag
     4621 tcaccaaatt agaggagata cgaaactttt ttttttaatt caaacttcta tcgcttctac
     4681 gtttagcttt tttcttcaaa tttttttaaa attttaatct ggtgaatcaa agatcaaatg
     4741 ttaatttccc tttgcgtctt tcgtctcatt ttttgtcacc aaaagacctc tttcgcctcc
     4801 cagttgttcc aattttgtcc cccgtttcca cgcccactca attttaccgg taattatttt
     4861 tttttctcgg cagaatttta actgtaatag ctttaattta ttttattata tcatttgcaa
     4921 atttcactta taatcagctt ttcattgtct ttggagcttt ttttgaagct ctcccctcaa
     4981 aatacttgta ccctttttgg tggtcctaat ttattacaga ttttattatt ttatatgaag
     5041 cttt
//