Dbfetch

LOCUS       NM_001306748            3117 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001306748
VERSION     NM_001306748.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3117)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3117)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3117)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3117)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3117
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>3117
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..3117
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1l"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001293677.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1l"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:A0A067XG44"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="UniProtKB/TrEMBL:A0A067XG44"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MFKYDPENDDLVEPVDSFVPEVDPKATAYDRLDPGQIMYAATAH
                     DLDLAKTVQQVKKGDTIKDPDSRALIAVSEPEARKPGGTEETDGDEDEDNKDSKVEST
                     AKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKLTDI
                     RSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFA
                     IMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMP
                     YNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANL
                     TDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNM
                     EELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFG
                     EGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLH
                     IWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGM
                     TNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAA
                     YPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIE
                     GYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLK
                     GYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEFTRPYDPNENA
                     ALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSI
                     GNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAK
                     LWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVGRGLVRGIF
                     TTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWT
                     RMSKKKQE"
     STS             379..1412
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgttcaaat acgatcctga aaatgatgat cttgtggaac ccgtcgacag ttttgtacca
       61 gaagttgatc ccaaggcaac tgcatatgat cgacttgatc ctggacagat aatgtacgct
      121 gccaccgctc acgacctcga cctcgccaaa actgtacagc aagtcaagaa aggcgatact
      181 atcaaagatc ctgattcacg tgctcttatc gctgtttctg aaccagaagc tcgtaagcca
      241 ggaggcactg aagaaacgga tggtgatgaa gatgaggata ataaggattc gaaagtggaa
      301 agtactgcta aattcattca aaaaatgatc gcttctgcct tggacttgtg tagtgtaaca
      361 ctaaacaaac tgtgcagaga acaccgatat gttggatttg ttttgagcaa ggaaaaacaa
      421 aagttgaagt caggacactc ggaatctctt tcaaatacat ctagaaagct gacggatatt
      481 cgatctgcag ttgatctacc aagtcttcaa cttgtgcaat cggcgaatga tgttgaaaag
      541 atggagacag ccgtcagcgt ggattggcaa caaaaatcat cagcaacgag actattgaat
      601 gcagttgtga attgtattgg agcacacact gatattctct gctacttctt cgcaattatg
      661 acacaagtga tgactggtgg acttattact cttccacttc ctctgatgtc actattctgg
      721 ggaaatctat cgaatcctcg tccatccaag ttcttctggg tcacaatgat cacctacact
      781 gagtgtgtca ttgttatcaa gtttgtttgc caatttgcat tcatgcctta caattctatc
      841 acgtggcgaa cagagcatca aatggacccg atgtcattgg ataagttatt cggagtatca
      901 cagagagata gttttgcact ttgggacatt gttttgctct tctcactctt cttccatcgg
      961 tatatgctca gaaagttagg gttatggaag gatgccaatt tgacggacac gttcactttg
     1021 aaggaagagc ctcgatcggc gtcaggatcg gacacaggat cacccaagaa aattgctcaa
     1081 gagccaaagg ttgttgtaac tcagtcagat acccttgaag gtacaagtgg aggagagata
     1141 gtcataccat ctgatccaaa tgcagtttcc aatatggaag aattagactg cgaacctccg
     1201 attccagaga agcaaagtgg accaattgga agattcattc atcaattatt ccatccaaaa
     1261 ttccgttaca ttcgtgattt gtatccaata atgtttggaa tcgatgtgat atgcttcctc
     1321 atcatgacat ttggatactc ggcatttggt gaaggaggtt ctggaaatgt tttagatgat
     1381 gtgaaggctt ctcgtattcc ggtaacactt gttgttatgc tcgttggaat gactctggca
     1441 attatcattg atcgagcact ctacctcaga aaatcagttg tcggaaagct aatctatcaa
     1501 gtcttaatga ttgctttcct tcacatttgg gtattccttg ttcttccaaa tatgactcgt
     1561 cgttctgcga tatcgaatca cgttgctcaa gcattgtacg tcatcaaatc gtgctatttc
     1621 cttgtgtctg cttggcagat ccgaaatggt tatcctgaac tttgtattgg aaatctatta
     1681 acacattcat acggaatgac caatatgatt gcattcaaag tattcatgaa tattccattc
     1741 ctcttcgagc ttcgtacagc tattgattgg acatggacag atacttcaat gcctcttttc
     1801 gatttcttca atatggaaaa tttctatgct catatattca atatcaagtg tgcccgccag
     1861 ttcgaagctg cctatccagc tccaagaggg attcccaaag gaaagttggt caagtatatg
     1921 atgggattcc caattatcat tggagtcgtt atcttcatct tttctcctct attgctctgg
     1981 tcgctactca atcaaatcgg aactatcagt atgccagaaa aagttacgtt gaggatttcg
     2041 attgaaggat atccaccact ttacgagatg gaggcacaag gaagtaatca cgataacgct
     2101 gaacttggaa tgataaaacc tgatcaattg gcatctttga atcaagcatt gacggatagt
     2161 tacacgacac gagacactaa ttctatttta agatcaagaa tgtctgtatc atatctgaaa
     2221 ggatacacat atgaggatat tctgattgtg cgattccgtc cagaatctga aatttattgg
     2281 ccgatttcac aggattcgag aaatgcgatg atcgataaat tgagccgaaa cacgtcagtc
     2341 aattttgaag tatctctgga attcactcgg ccatatgatc caaatgaaaa cgctgcttta
     2401 aaacattcga aatcgtggct tgttccaatc tccctggata tgacgattcg agcaaaaatt
     2461 caaagtgctc tccgaggaga tccaggtcat ccgattctca ttccacagtc aattcctgcg
     2521 tttattcaag ttccaaatca aggagaattg acccttccaa catcaatcgg aaatactatt
     2581 atcaatgacg gaaatccacg gattaatacg accgggatgg aaaaatcaga cgaagctcgg
     2641 gcttggttcg actcgttaac cttgaatctc gaacaaggaa aatcgcaaaa cgagaaaatg
     2701 tggatcgcca catccgaaca tccaggagac caaaatgcga aactctggat aaagactgca
     2761 aatacgacgt attcgggaag gccgtacctt caagttgtcg gatttattga tagagcattc
     2821 ccatcatttt tggcgaaagt tttcaaagga ggagtcattg cagtgtatct ttcagttatc
     2881 ctcgtcgttg gaagaggtct ggttcgtgga atcttcacca catctccaag cactgtcatg
     2941 ttcacagaat taccgaatgc ggatcatctt ctcaaaattt gtctcgacat ctatttggtt
     3001 cgagaagcga aggacttcat gttggagcag gatctcttcg ccaaattaat attcctgttc
     3061 cgatcaccag cgacactcat cgaatggaca cgaatgagca aaaagaagca agaataa
//