Dbfetch

LOCUS       NM_001268741            1164 bp    mRNA    linear   INV 21-JAN-2020
DEFINITION  Caenorhabditis elegans Calcium-dependent secretion activator
            (unc-31), partial mRNA.
ACCESSION   NM_001268741
VERSION     NM_001268741.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1164)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1164)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1164)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1164)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Sep 4, 2019 this sequence version replaced NM_001268741.1.
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..1164
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..1164
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /db_xref="GeneID:178233"
                     /db_xref="WormBase:WBGene00006767"
     CDS             1..333
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /standard_name="ZK897.1g"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Calcium-dependent secretion activator"
                     /protein_id="NP_001255670.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006767"
                     /db_xref="EnsemblGenomes-Tr:ZK897.1g"
                     /db_xref="GeneID:178233"
                     /db_xref="GOA:G3MU01"
                     /db_xref="InterPro:IPR033227"
                     /db_xref="UniProtKB/TrEMBL:G3MU01"
                     /db_xref="WormBase:WBGene00006767"
                     /translation="MKSINEWLTERLQQSLSATQYISLSTIVKKVYQDFSLQGIDEER
                     LNSKTYQSISRRLQLEESNSHIQEAAINGSAQGSVFPTSLGNATAAVSNMSSMVEGAG
                     AKMFSLFK"
ORIGIN      
        1 atgaaatcaa tcaatgaatg gttgacagaa cgtcttcaac aatcgttgag tgcaactcaa
       61 tacatttccc tttcgacaat tgtaaaaaaa gtgtatcaag acttttcact gcaaggaatc
      121 gatgaagaac gactgaatag taagacttat cagtcaatca gtcgacgatt acagcttgaa
      181 gagtcaaatt ctcatattca agaagccgcc atcaatggat cagctcaagg ttcggtgttt
      241 cccacgtcgt tggggaacgc gacagcagcc gtatccaaca tgtcaagtat ggtcgaagga
      301 gccggtgcaa agatgttctc gctttttaaa tagatttttt ctaatatttt tctttaagcg
      361 gtgttttctc acgggattta tttgaaatag accatttcga acagaaatgc caagaagtgg
      421 gaggagatta aggctcctcc cagttcttgg tgattagtaa acagagtcgt gccctcagaa
      481 taatgccgtt tttattttaa agttatagtt tcatattttt ataattattc aaatttaaaa
      541 acgctttcaa ttatacgagt ttcatttagt ttatggaaag atttttaatc gaccgtattt
      601 tctcaacttt gccagctcat atctcagcta tctttggttg tattaaaaca atttcaactg
      661 gaaacgtgtt ccttatttat ttttctataa atgcatagtt taaaattgtt tgatatctcc
      721 aacatgagcc gagatattag tcaccaaatt agaggagata cgaaactttt ttttttaatt
      781 caaacttcta tcgcttctac gtttagcttt tttcttcaaa tttttttaaa attttaatct
      841 ggtgaatcaa agatcaaatg ttaatttccc tttgcgtctt tcgtctcatt ttttgtcacc
      901 aaaagacctc tttcgcctcc cagttgttcc aattttgtcc cccgtttcca cgcccactca
      961 attttaccgg taattatttt tttttctcgg cagaatttta actgtaatag ctttaattta
     1021 ttttattata tcatttgcaa atttcactta taatcagctt ttcattgtct ttggagcttt
     1081 ttttgaagct ctcccctcaa aatacttgta ccctttttgg tggtcctaat ttattacaga
     1141 ttttattatt ttatatgaag cttt
//