Dbfetch

LOCUS       NM_001268739            3624 bp    mRNA    linear   INV 21-JAN-2020
DEFINITION  Caenorhabditis elegans Calcium-dependent secretion activator
            (unc-31), partial mRNA.
ACCESSION   NM_001268739
VERSION     NM_001268739.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3624)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3624)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3624)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3624)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Sep 4, 2019 this sequence version replaced NM_001268739.1.
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..3624
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..3624
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /db_xref="GeneID:178233"
                     /db_xref="WormBase:WBGene00006767"
     CDS             1..2793
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /standard_name="ZK897.1e"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Calcium-dependent secretion activator"
                     /protein_id="NP_001255668.1"
                     /db_xref="GeneID:178233"
                     /db_xref="WormBase:WBGene00006767"
                     /translation="MEVVVMEVQGLKSVQPSKIVYCTMEVDGHKLQTDHAEASKPKWD
                     TQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQPTPNCARSPEWYTMTLPKS
                     SQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRFFCLVQVSQYAFAVCSFR
                     QKKADPTEFIQLDGFTIDYMPESDPELSAQGGKHFFTAIKEGDELKFATDDENERHLW
                     VQALYRATGQAYKPVPPKQSTIAPKAQGFQDKASKHGMDAMIQADSINFDHDHFYSDV
                     QRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCFRHVTLLSNLLDKADDGLL
                     IDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEKFQEIKERLRVLLEKQI
                     TNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVIRKCLEDAALVNYTR
                     ICNEAKIEQRMGIDVSPAQRIEDMIRVTEFCIDLLKENEEHHGEAFAWFSDLLSDHSE
                     IFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIFHNKIVQQFQPLV
                     VRYIDLMEHSIAQAIDKGFSKEKWESRKEGCATSEDIYWKLDALHTFVIDLNWPEEDF
                     RKYLQTKMKSLTSDMISKVSDCTFTAFDSWMQRAKKSTDYMLPSEVCVQINVMFSSKS
                     RAVRVTVDSGEYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYDEGNPIG
                     AILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQIGNSYVTFFHGCTEL
                     LRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQDFS
                     LQGIDEERLNSKTYQSISRRLQLEESNSHIQEAAINGSAQGSVFPTSLGNATAAVSNM
                     SSMVEGAGAKMFSLFK"
ORIGIN      
        1 atggaggttg tcgtgatgga agtgcagggt ctaaaatccg tgcaacccag taaaatagtg
       61 tattgcacga tggaagtaga cggtcacaag ctgcagacag atcatgcgga ggcttccaaa
      121 ccaaaatggg atacacaagg agacttttcg acgaaaaatc cattgcccgt ggtgaaagtg
      181 aaattgtata cagaagtgaa gagtatgata gcatttgagg ataaagaatt aggaaaagta
      241 ataatccagc cgacgccaaa ctgtgcgcga agtccagaat ggtacaccat gacattacca
      301 aaaagtagtc aggatcagaa tttaaagatt aggatagcaa ttcgagtaga aaaaccgccg
      361 aatttaaagt attgcggtta ttgttattgt atcgggcgaa acgcgtggaa gaagtggaag
      421 aagcgattct tttgtcttgt tcaagtatct cagtacgcat ttgctgtatg tagttttcga
      481 caaaagaagg ccgatcccac ggaattcatt caattagacg ggtttacgat cgattatatg
      541 ccggagtcgg atccagaact ctctgcgcaa ggaggaaaac acttcttcac tgccatcaaa
      601 gaaggagacg agctgaaatt tgcgactgat gacgaaaatg agcgacatct atgggtccag
      661 gctctgtacc gagccacagg tcaagcctat aaacctgtgc ctccaaagca gtcaacaatt
      721 gctccaaagg ctcaaggttt ccaggataaa gccagcaaac atggaatgga tgcaatgatt
      781 caggctgatt cgattaattt cgatcatgac catttttatt ccgatgttca acgattaact
      841 ctggattttc ggatcaacga gccgatttgt tcattgggtt ggttctcacc tggtcaagca
      901 tttgttctgg aagaatactc tgctcgatat atggttcgtg gatgcttccg ccacgtaacc
      961 ctcttatcaa atcttttgga taaagctgac gatggattgc tcattgatcc agctctaatt
     1021 cattactctt tcgctttttg tgcatctcat gtccatggaa ataggtgtat gcctgatcga
     1081 caaggacctg aaggagttgg tacagtaact ctggaggaga aggaaaagtt ccaggaaatc
     1141 aaggaacgat tgagagtact tctagagaag caaatcacga atttccgtta ttgtttccca
     1201 tttggaagac ctgaaggcgc acttaaaggg acattaggtc tattggaaag agttttgatg
     1261 aaggatgttg tgtcgccagt tccaccggaa gaagttcgag cagttattag aaaatgtttg
     1321 gaggatgctg cattggttaa ttacacaagg atttgcaatg aagcaaagat tgaacaacga
     1381 atgggtattg atgttagtcc ggctcaacga atcgaggaca tgatccgcgt gacggaattc
     1441 tgcattgatc tgctcaagga gaacgaggag catcatggag aggctttcgc gtggttttcc
     1501 gaccttcttt ccgaccattc cgagatcttt tggtcattgt attcagtcga cttggactcg
     1561 gcactggaag ttcaaccaca cgatagttgg gattctttcc ctcttttcca gatgctcaac
     1621 gactttttgc tgtctgaatc aagcctgaaa ggaggtatat tccacaacaa aatcgttcaa
     1681 caattccaac ctctcgttgt acgatacatt gacctcatgg agcactcgat tgctcaggcg
     1741 attgacaaag gattttccaa ggaaaaatgg gaatcaagaa aagaaggatg tgcaacttcg
     1801 gaagatattt actggaagct cgacgctctt cacacatttg tcatcgatct gaactggcct
     1861 gaagaggatt tcagaaaata tttgcagacg aaaatgaaaa gtctaacttc tgatatgata
     1921 tccaaggttt ccgattgcac cttcaccgca ttcgacagtt ggatgcaacg agccaaaaag
     1981 tccaccgatt acatgcttcc atcagaagtt tgcgtgcaaa tcaacgtaat gttcagctca
     2041 aagagccgtg ctgttcgagt cactgttgat tctggagaat acaaatatca gtcaaaactc
     2101 gacgaaactc tggagacaat gctcaaaact atggaatcat gtattcaaga gaaacttcac
     2161 ggagttcttg aatcagtgct ctcacgtctt gctcgatacg acgagggaaa tccgattgga
     2221 gcaattttga atattgcccc aaagcctgca tcgattttca acaaattgaa gacaatggcc
     2281 ggagacacct cggctcaggc aacgacgaca gcgcgtcaac ctctgactgc tcaacaatca
     2341 tcagggcaaa tcggaaattc atatgttaca tttttccacg gatgcactga acttcttcga
     2401 caagttatta tcgatgaaat ttgggttaat gggctcttcg agcattggta cgacaaccaa
     2461 atgaaatcaa tcaatgaatg gttgacagaa cgtcttcaac aatcgttgag tgcaactcaa
     2521 tacatttccc tttcgacaat tgtaaaaaaa gtgtatcaag acttttcact gcaaggaatc
     2581 gatgaagaac gactgaatag taagacttat cagtcaatca gtcgacgatt acagcttgaa
     2641 gagtcaaatt ctcatattca agaagccgcc atcaatggat cagctcaagg ttcggtgttt
     2701 cccacgtcgt tggggaacgc gacagcagcc gtatccaaca tgtcaagtat ggtcgaagga
     2761 gccggtgcaa agatgttctc gctttttaaa tagatttttt ctaatatttt tctttaagcg
     2821 gtgttttctc acgggattta tttgaaatag accatttcga acagaaatgc caagaagtgg
     2881 gaggagatta aggctcctcc cagttcttgg tgattagtaa acagagtcgt gccctcagaa
     2941 taatgccgtt tttattttaa agttatagtt tcatattttt ataattattc aaatttaaaa
     3001 acgctttcaa ttatacgagt ttcatttagt ttatggaaag atttttaatc gaccgtattt
     3061 tctcaacttt gccagctcat atctcagcta tctttggttg tattaaaaca atttcaactg
     3121 gaaacgtgtt ccttatttat ttttctataa atgcatagtt taaaattgtt tgatatctcc
     3181 aacatgagcc gagatattag tcaccaaatt agaggagata cgaaactttt ttttttaatt
     3241 caaacttcta tcgcttctac gtttagcttt tttcttcaaa tttttttaaa attttaatct
     3301 ggtgaatcaa agatcaaatg ttaatttccc tttgcgtctt tcgtctcatt ttttgtcacc
     3361 aaaagacctc tttcgcctcc cagttgttcc aattttgtcc cccgtttcca cgcccactca
     3421 attttaccgg taattatttt tttttctcgg cagaatttta actgtaatag ctttaattta
     3481 ttttattata tcatttgcaa atttcactta taatcagctt ttcattgtct ttggagcttt
     3541 ttttgaagct ctcccctcaa aatacttgta ccctttttgg tggtcctaat ttattacaga
     3601 ttttattatt ttatatgaag cttt
//