Dbfetch

LOCUS       NM_001268738            4142 bp    mRNA    linear   INV 18-OCT-2019
DEFINITION  Caenorhabditis elegans Calcium-dependent secretion activator
            (unc-31), mRNA.
ACCESSION   NM_001268738
VERSION     NM_001268738.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4142)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4142)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4142)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4142)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Sep 4, 2019 this sequence version replaced NM_001268738.1.
FEATURES             Location/Qualifiers
     source          1..4142
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            1..4142
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /db_xref="GeneID:178233"
                     /db_xref="WormBase:WBGene00006767"
     CDS             25..4050
                     /gene="unc-31"
                     /locus_tag="CELE_ZK897.1"
                     /standard_name="ZK897.1b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Calcium-dependent secretion activator"
                     /protein_id="NP_001255667.1"
                     /db_xref="GeneID:178233"
                     /db_xref="WormBase:WBGene00006767"
                     /translation="MLGASSSEEEDDDFQEDHDSLPIAQVKKRSLLSGAMTPRSSSPA
                     PSDSVSQTNSLKRNNSSSQGRRKDSVQSQTPARSARIMSNVSKPIMQNSQEFDGDEEE
                     GEEGSTTVVGSGDECGGPALSKEEQERMKAEREEEDHKKNLQMYMFLARCIAYPFNGQ
                     QTGDMARRQMKVNKQELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQ
                     KVVHAGGFSQHDFREVFRLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKGDETDQ
                     NRNARGRSRNPQNAMSADAVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAA
                     AIRREFATREEALKDPIKMKRLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTR
                     GATVGKRKDKSRSRSIEDLSLFNSLKRRTSSGSLNKGDSEDGDVTLTKSDVSLALSME
                     VVVMEVQGLKSVQPSKIVYCTMEVDGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKV
                     KLYTEVKSMIAFEDKELGKVIIQPTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEK
                     PPNLKYCGYCYCIGRNAWKKWKKRFFCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFT
                     IDYMPESDPELSAQGGKHFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVP
                     PKQSTIAPKAQGFQDKASKHGMDAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSL
                     GWFSPGQAFVLEEYSARYMVRGCFRHVTLLSNLLDKADDGLLIDPALIHYSFAFCASH
                     VHGNRCMPDRQGPEGVGTVTLEEKEKFQEIKERLRVLLEKQITNFRYCFPFGRPEGAL
                     KGTLGLLERVLMKDVVSPVPPEEVRAVIRKCLEDAALVNYTRICNEAKIEQRMGIDVS
                     PAQRIEDMIRVTEFCIDLLKENEEHHGEAFAWFSDLLSDHSEIFWSLYSVDLDSALEV
                     QPHDSWDSFPLFQMLNDFLLSESSLKGGIFHNKIVQQFQPLVVRYIDLMEHSIAQAID
                     KGFSKEKWESRKEGCATSEDIYWKLDALHTFVIDLNWPEEDFRKYLQTKMKSLTSDMI
                     SKVSDCTFTAFDSWMQRAKKSTDYMLPSEVCVQINVMFSSKSRAVRVTVDSGEYKYQS
                     KLDETLETMLKTMESCIQEKLHGVLESVLSRLARYDEGNPIGAILNIAPKPASIFNKL
                     KTMAGDTSAQATTTARQPLTAQQSSGQIGNSYVTFFHGCTELLRQVIIDEIWVNGLFE
                     HWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQDFSLQGIDEERLNSKTYQS
                     ISRRLQLEESNSHIQEGIRKH"
ORIGIN      
        1 tttgcagtct tcgtttggaa catcatgtta ggagcaagta gtagtgaaga agaagacgac
       61 gattttcagg aggatcatga ttcgctacca attgcacagg tcaaaaagcg atcactgctc
      121 tccggggcga tgacaccaag gagcagctca ccggctccgt cggactcggt ttcacagaca
      181 aattcgttga aaagaaacaa ttcgagttca cagggaagaa ggaaagattc agtgcaaagt
      241 cagacacctg ctagatcggc gagaataatg tcgaatgttt caaagccgat aatgcaaaat
      301 tcacaagaat tcgatggaga tgaggaagaa ggggaagaag gttcaactac agtagtcggt
      361 agtggagatg aatgtggtgg tcctgctttg agcaaagaag agcaggaaag aatgaaagcc
      421 gaacgagagg aagaagatca taagaagaat cttcaaatgt acatgtttct agccagatgc
      481 atagcatatc cattcaatgg acagcagact ggtgacatgg ctcgtcgaca aatgaaagtg
      541 aataaacagg aattggctag aattcgagaa cgattcactc tttttcttaa aggagaaaca
      601 aatattgctg ctgatgaagc attcactaaa gcgattcaaa gttatttcga agtatttctg
      661 aaatctgaaa gagttcagaa agttgttcac gccggcggat tttcacaaca tgattttcga
      721 gaagtttttc gattaaatat tgagaaaagg gttcgaagtc ttcctgatat tgaaggatta
      781 tcaaaggata ctgtattgaa ttcttggtta gcaaaattcg atgcaattat taaaggagat
      841 gagactgatc agaataggaa tgctcgaggc cgctctcgaa atccgcagaa tgcgatgagc
      901 gctgacgcag tactaggcaa agagcaactc tacgacgttt ttcaacaaat tcttggtgtg
      961 aagaaattcg agcatcaaat catattcaac gcacttcagt tggataatcc agatgagcag
     1021 gcggcagcaa tccggagaga gtttgcgaca agagaagaag ctttgaagga tcctatcaag
     1081 atgaagcgtc ttactccaaa atttgtggta aaagacatgg aaaccctgta catggacgaa
     1141 gttcgaatgt cgataaacac tttaatagga aatttggaaa cagttccagt gacaacacga
     1201 ggggcaactg tcggaaaacg aaaagacaag agtcgatccc gcagtataga ggatttgtcg
     1261 ctcttcaaca gccttaaacg aaggacaagc tccgggagtc tcaacaaagg agatagtgaa
     1321 gatggtgacg tcacactgac aaagtctgat gtctcattgg ctttgagtat ggaggttgtc
     1381 gtgatggaag tgcagggtct aaaatccgtg caacccagta aaatagtgta ttgcacgatg
     1441 gaagtagacg gtcacaagct gcagacagat catgcggagg cttccaaacc aaaatgggat
     1501 acacaaggag acttttcgac gaaaaatcca ttgcccgtgg tgaaagtgaa attgtataca
     1561 gaagtgaaga gtatgatagc atttgaggat aaagaattag gaaaagtaat aatccagccg
     1621 acgccaaact gtgcgcgaag tccagaatgg tacaccatga cattaccaaa aagtagtcag
     1681 gatcagaatt taaagattag gatagcaatt cgagtagaaa aaccgccgaa tttaaagtat
     1741 tgcggttatt gttattgtat cgggcgaaac gcgtggaaga agtggaagaa gcgattcttt
     1801 tgtcttgttc aagtatctca gtacgcattt gctgtatgta gttttcgaca aaagaaggcc
     1861 gatcccacgg aattcattca attagacggg tttacgatcg attatatgcc ggagtcggat
     1921 ccagaactct ctgcgcaagg aggaaaacac ttcttcactg ccatcaaaga aggagacgag
     1981 ctgaaatttg cgactgatga cgaaaatgag cgacatctat gggtccaggc tctgtaccga
     2041 gccacaggtc aagcctataa acctgtgcct ccaaagcagt caacaattgc tccaaaggct
     2101 caaggtttcc aggataaagc cagcaaacat ggaatggatg caatgattca ggctgattcg
     2161 attaatttcg atcatgacca tttttattcc gatgttcaac gattaactct ggattttcgg
     2221 atcaacgagc cgatttgttc attgggttgg ttctcacctg gtcaagcatt tgttctggaa
     2281 gaatactctg ctcgatatat ggttcgtgga tgcttccgcc acgtaaccct cttatcaaat
     2341 cttttggata aagctgacga tggattgctc attgatccag ctctaattca ttactctttc
     2401 gctttttgtg catctcatgt ccatggaaat aggtgtatgc ctgatcgaca aggacctgaa
     2461 ggagttggta cagtaactct ggaggagaag gaaaagttcc aggaaatcaa ggaacgattg
     2521 agagtacttc tagagaagca aatcacgaat ttccgttatt gtttcccatt tggaagacct
     2581 gaaggcgcac ttaaagggac attaggtcta ttggaaagag ttttgatgaa ggatgttgtg
     2641 tcgccagttc caccggaaga agttcgagca gttattagaa aatgtttgga ggatgctgca
     2701 ttggttaatt acacaaggat ttgcaatgaa gcaaagattg aacaacgaat gggtattgat
     2761 gttagtccgg ctcaacgaat cgaggacatg atccgcgtga cggaattctg cattgatctg
     2821 ctcaaggaga acgaggagca tcatggagag gctttcgcgt ggttttccga ccttctttcc
     2881 gaccattccg agatcttttg gtcattgtat tcagtcgact tggactcggc actggaagtt
     2941 caaccacacg atagttggga ttctttccct cttttccaga tgctcaacga ctttttgctg
     3001 tctgaatcaa gcctgaaagg aggtatattc cacaacaaaa tcgttcaaca attccaacct
     3061 ctcgttgtac gatacattga cctcatggag cactcgattg ctcaggcgat tgacaaagga
     3121 ttttccaagg aaaaatggga atcaagaaaa gaaggatgtg caacttcgga agatatttac
     3181 tggaagctcg acgctcttca cacatttgtc atcgatctga actggcctga agaggatttc
     3241 agaaaatatt tgcagacgaa aatgaaaagt ctaacttctg atatgatatc caaggtttcc
     3301 gattgcacct tcaccgcatt cgacagttgg atgcaacgag ccaaaaagtc caccgattac
     3361 atgcttccat cagaagtttg cgtgcaaatc aacgtaatgt tcagctcaaa gagccgtgct
     3421 gttcgagtca ctgttgattc tggagaatac aaatatcagt caaaactcga cgaaactctg
     3481 gagacaatgc tcaaaactat ggaatcatgt attcaagaga aacttcacgg agttcttgaa
     3541 tcagtgctct cacgtcttgc tcgatacgac gagggaaatc cgattggagc aattttgaat
     3601 attgccccaa agcctgcatc gattttcaac aaattgaaga caatggccgg agacacctcg
     3661 gctcaggcaa cgacgacagc gcgtcaacct ctgactgctc aacaatcatc agggcaaatc
     3721 ggaaattcat atgttacatt tttccacgga tgcactgaac ttcttcgaca agttattatc
     3781 gatgaaattt gggttaatgg gctcttcgag cattggtacg acaaccaaat gaaatcaatc
     3841 aatgaatggt tgacagaacg tcttcaacaa tcgttgagtg caactcaata catttccctt
     3901 tcgacaattg taaaaaaagt gtatcaagac ttttcactgc aaggaatcga tgaagaacga
     3961 ctgaatagta agacttatca gtcaatcagt cgacgattac agcttgaaga gtcaaattct
     4021 catattcaag aaggtatacg aaaacattaa attttttata attatttact agttgttatt
     4081 tgttgttgtt gtgaacagtg aaacggattt gtgaattaat gattttaaat tattgtgttc
     4141 gt
//