Dbfetch

LOCUS       NM_001268540            3441 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Rap guanine nucleotide exchange factor
            (pxf-1), partial mRNA.
ACCESSION   NM_001268540
VERSION     NM_001268540.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3441)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3441)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3441)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3441)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3441
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>3441
                     /gene="pxf-1"
                     /locus_tag="CELE_T14G10.2"
                     /db_xref="GeneID:177894"
                     /db_xref="WormBase:WBGene00004254"
     CDS             1..3441
                     /gene="pxf-1"
                     /locus_tag="CELE_T14G10.2"
                     /standard_name="T14G10.2g"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Rap guanine nucleotide exchange factor"
                     /protein_id="NP_001255469.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004254"
                     /db_xref="EnsemblGenomes-Tr:T14G10.2f"
                     /db_xref="EnsemblGenomes-Tr:T14G10.2g"
                     /db_xref="GeneID:177894"
                     /db_xref="GOA:G5ECB8"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008937"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR036034"
                     /db_xref="UniProtKB/TrEMBL:G5ECB8"
                     /db_xref="WormBase:WBGene00004254"
                     /translation="MSVDSIAMPPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDF
                     PVDIPTTSSSSSNTSYNDQHRSQVYLNGLSADEDTLVRVKHRREKSNSVGGQAQNGIS
                     TARRLRGRSTASSTTTEGETASNEGADSDEDEGSMPSQESSSGGFMDLRDSVRECLEK
                     EPSERNSEDLAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLD
                     SWSVIVNGCVEVVKPSGERVEYKLGDSFGAEPTPATQIHIGEMRTMVDDCEFVLVEHR
                     DFCSIMSTIGDHIEKDRDGLTGEVVSEVERRTVGTHCGQVLIKGKPDKLIHHLVDERD
                     HNVDPHYVDDFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLLWVNNHFNDFE
                     TNDEMWNLLERFEGALERDGMHSQLSLLNIACSVKAKPRQVILTRRKDDKMMMRLVGG
                     QESGNSVYVAEVFPDTSAAREGVKRADEMLEVNQQSAKYLSAKKAEDLLTGSLSLTLM
                     LKNNVLGYKETIGKIEHNKPKNGTSRSGAGIPMVIPVHKTSITGKKSSTTSSKSGMME
                     KLMTILKSSKEDSMDFTDEAKISSADLRPSRSNPDITSISQYYGPVRSECPEHVLKIY
                     RNDQTFKYLPVYKETSAQNVVQLALQEFNMTAEGSPEWSLCECTVTIDGVIKQRRLPP
                     QMENLAERIALNSRYYLKNNSRSEPLVPDELAPELLKEAQTQLLSLNAQVVAAQLTLQ
                     DFSVFSAIEPTEFLDNLFKLDSKYGSPKLEEFEQLFNREMWWVATEICTERHVQKRAK
                     LIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLV
                     DPSRNMSKYRQHLAEVAQEPPVVPIYPVIKKDLTFAHDGNATYSEKLINFEKLRLIAK
                     SIRGVMKLSSAPYEIASMAERSGGVVMDALLHMNSFENSNVATMRKGMSGKQNQPRKK
                     VYEQALMVRKVKSYLEGLHVVDNEMELDSMSYDIEPQVQTAHRGANSSSTANIRRVPS
                     PTPSSLSSQSAGSADQSSRHRLLFNGTGSISSAGGGSKFGVESPQAVQKMLSLVQNSK
                     VKGAPPQITSPSTSARSSLQRNMPRVTGRQATSSAQGPVQLNEETSTVTTYYQSDVLI
                     "
ORIGIN      
        1 atgtcagttg attcaattgc aatgccgcca cctccagttc cacctcgtcc tctacgtctt
       61 ccacaaactg cagctaaagg cccagctcct ctgccgccac gtggtttacc tagaacatat
      121 ccattggatt ttcctgtaga tattccaaca acgtcatcat catcatcaaa cacttcatat
      181 aatgatcaac atcgtagtca agtatatttg aatggattat ccgctgatga agatactctt
      241 gttcgagtga agcatagaag agagaaaagc aattcagttg gaggacaagc ccagaatgga
      301 atttcaactg ctcggaggct tcgaggaaga agcacagcat catctacaac tactgaaggt
      361 gaaacagctt ccaacgaagg agcagattca gacgaagatg aagggagtat gccttcacaa
      421 gaatcaagta gtggaggatt catggatctg cgagattctg tccgagaatg tcttgaaaag
      481 gaaccttcag aacgaaattc agaagatctt gcagttttac tcgatttcat gcaacatatg
      541 tccgcatttg ccgctttgcc gatgtcaata aaacgtcagt tatgcttgaa aatggttttt
      601 gcggtagtaa acgatgcggg tacggtagtt cttgctcaca acgagaaact cgattcatgg
      661 tctgtaatag tgaatggatg tgtagaagtt gtaaaaccat ctggtgagcg tgttgaatac
      721 aagctcggag attcatttgg tgcagaacca acacctgcaa cacaaattca tatcggtgaa
      781 atgagaacaa tggtggatga ttgtgaattc gtacttgttg aacatcgaga tttttgttca
      841 attatgtcga caattggtga tcatattgaa aaagatcgag acggtttgac aggagaagtt
      901 gtgtcagaag ttgaacgaag gactgttgga actcattgtg gacaagtgct tatcaaagga
      961 aaaccagaca aattaataca ccatttagtg gatgaacgag atcataatgt tgatccacac
     1021 tatgtcgacg attttctatt gacctatcga gttttcataa gagatccaac tacgattttc
     1081 gagaaattga tgctctggtt tgccgattct atatatcgag ataaagttgc aagattggtt
     1141 cttctatggg ttaataatca ttttaatgat ttcgagacga acgatgagat gtggaatcta
     1201 ttagaacgtt ttgaaggagc attagaaaga gatggaatgc attctcaact atctttattg
     1261 aatattgcat gttctgtaaa agcaaaacct cgacaagtga tattaacaag gagaaaagat
     1321 gacaaaatga tgatgagatt agttggaggt caagaatcag gcaactctgt atacgtggcc
     1381 gaagtcttcc cagatacgtc agcagcgaga gaaggtgtga agagagctga tgaaatgtta
     1441 gaagtgaatc aacaatcagc taaatattta tcagccaaaa aagcggaaga tctactaacg
     1501 gggtctctgt cattaacttt gatgctcaaa aataatgttc ttgggtacaa ggagacaatt
     1561 ggaaaaattg aacataataa gcctaaaaat ggaacatcaa gatctggtgc cggaattcca
     1621 atggtaattc cagttcacaa aacttcaata actggaaaga aatcatcgac gacaagtagc
     1681 aaatcgggta tgatggaaaa attgatgaca atattgaaat catcaaaaga agattcaatg
     1741 gatttcactg atgaagctaa gatatcatca gccgatcttc gtccaagtcg atccaatcct
     1801 gatatcacta gcatatcaca gtactacgga ccagtacgaa gcgaatgtcc tgaacacgtt
     1861 ctgaagattt atcgaaatga tcagacattc aaatatctgc cagtttacaa agaaacgtct
     1921 gctcagaatg ttgtacaact ggcattgcaa gagtttaata tgacagcaga aggaagtcca
     1981 gaatggtcac tttgtgaatg tactgttacg attgatggag ttataaaaca gagaaggtta
     2041 ccaccacaaa tggaaaattt ggctgaaaga atagctttga attcgagata ttatctgaaa
     2101 aacaatagtc gatctgaacc tcttgtacct gatgaattgg ctcccgaact tttgaaagag
     2161 gcccaaactc aactgctcag tttaaatgct caagtcgttg ctgctcaact aactttgcaa
     2221 gacttttcag ttttttcagc aattgaacca acagaatttc tagataactt attcaagctg
     2281 gattccaagt acggctcccc aaaacttgaa gaattcgaac agttattcaa tcgtgaaatg
     2341 tggtgggtgg cgacagagat ttgcacagaa agacatgttc aaaaacgtgc aaaactgatt
     2401 aaaaagttta taaaagtggc gagatattgt cgggatcttc gaaatttcaa ttcaatgttt
     2461 gctattatga gtggacttga taagccagca gttcgtaggt tgcattccag ttgggaacgg
     2521 gtttcgagta aatacattcg tatgcttgat gaaatccatc aacttgtcga tccttctcgt
     2581 aatatgtcaa agtatcgtca acatcttgct gaagtcgccc aagaaccgcc tgttgtccca
     2641 atttatcctg taatcaaaaa agatctcaca tttgctcacg atggtaatgc aacatattct
     2701 gaaaaactaa tcaatttcga gaagcttcga cttattgcaa aatcaattcg aggtgtaatg
     2761 aaattgagta gtgcacctta tgaaattgct agtatggcag agaggagtgg tggagttgta
     2821 atggacgctc ttcttcatat gaattcattc gaaaattcaa atgtagccac aatgaggaag
     2881 ggaatgagtg gaaaacagaa tcagccacga aaaaaagttt atgaacaagc tcttatggta
     2941 cggaaagtga aatcatatct cgaaggatta catgttgttg ataatgaaat ggaattggat
     3001 tcaatgagtt atgacattga accacaagtt cagacagctc accgtggtgc taattcatca
     3061 tcgactgcaa atattcgtcg tgttccatct ccaactccat cgtcactttc ctctcaatca
     3121 gccgggtcag ccgatcaatc atctcggcat cgtcttcttt tcaatggaac cggctcaatt
     3181 tcgtcagctg gtggtggttc taaatttgga gtcgaatctc cacaagctgt acaaaaaatg
     3241 ctgtcacttg ttcagaattc caaagttaaa ggtgctccac ctcaaatcac atctccatcc
     3301 acatcagcaa gatcctctct tcaacggaat atgccacgtg taactggtcg acaagcgaca
     3361 tcctcggctc aagggccagt tcaactgaat gaagagacgt ctacggttac gacatattat
     3421 caatcagacg tgctcatcta a
//