Dbfetch

LOCUS       NM_001268461            7203 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001268461
VERSION     NM_001268461.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 7203)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 7203)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7203)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 7203)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Apr 20, 2015 this sequence version replaced NM_001268461.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..7203
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>7203
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..7203
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1b"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001255390.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1b"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:C6KRJ3"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:C6KRJ3"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MTVPPLLKSCVVKLLLPAALLAAAIIRPSFLSIGYVLLALVSAV
                     LPPIRKSLALPKLVGTFVIITFLFCLAVALGVGSYQISEQVVHKNDRTYICNRSDTTL
                     FRSIGLVRFHPTGTFESTRAFLPEIIATSAALLTIIIVMFLSHRDEQLDVVGDVVTVR
                     SESGREQRRQRKLAAIMWSAIGNSLRRLTNFVLFLFTAYVGIVKPSLSNSIYFLAFLF
                     ISTWWSTYTPLRHGVYNQIKKFLIFYSALHFLVLYTYQIPIVHHSWLPTGSFLPRLFG
                     LTVLMDSSCPEWWKFPFVAPDFNDDDLIMKWPLYANPIVVLVFFYLTVAQYKFTRNGS
                     REYIDDNEYGSSVHEELLSNASSSANDDEQGRARSRSPLRNGEEQGSIPLRKVTSQVV
                     DRNKLSNIFNTPGDKESAASKGMIAVMTFVIFHSYSIALTAMMTWALLYHSIFGLILL
                     ILTCILWIFRDTRKSSFAMAPIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGIEW
                     TTLPVHAVIILCVQTLLTLPVFLLLRLARREKFYESLSDYERQRRINSYGTFGASKTG
                     AGGVAVAKDPKSRKFAAFVEYLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILFFALW
                     ALNLIYLKFSFRLYRGLAYAFWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSLSQEW
                     LNAIGLVDFRAIGESGALFLQLLAPIALFVVTMLQLKFFHGPWSRATSPRRAENDPPT
                     STTEAAAVASTSGTQGRAHAAGDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAI
                     FIANNINALYIPLVILLSLAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPELS
                     QIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQR
                     HYRASLGLPESMRAKVFPDFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGIDIF
                     NRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEY
                     PWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREGED
                     NDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSL
                     FALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGC
                     VFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDV
                     IALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKF
                     NDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLVEPVD
                     SFVPEVDPKATAYDRLDPGQIMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALIAVSE
                     PEARKPGGTEETDGDEDEDNKDSKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVG
                     FVLSKEKQKLKSGHSESLSNTSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQ
                     QKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRP
                     SKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFA
                     LWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKV
                     VVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFR
                     YIRDLYPIMFGIDVICFLIMTFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVGMTLA
                     IIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSC
                     YFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTS
                     MPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIF
                     SPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLAS
                     LNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAM
                     IDKLSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDP
                     GHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSL
                     TLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFL
                     AKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVRE
                     AKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE"
     STS             2567..3442
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             4465..5498
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgacggtcc cgccgctttt aaaatcgtgc gtcgtcaaat tgctgcttcc ggcagcactg
       61 cttgcagctg ccataatccg gccgagcttt ttatcaattg gctacgtcct acttgcactt
      121 gtcagcgccg ttctgccacc aattcgaaag tctttagcac ttcccaaact agttggaaca
      181 ttcgttatta tcacttttct cttctgccta gcagtcgcac taggagttgg ttcctaccag
      241 atctcagaac aagttgttca taaaaatgac cggacataca tttgcaatcg atccgacact
      301 actctgttcc ggagcattgg ccttgtccga ttccatccaa caggaacatt tgaatcaact
      361 cgagcatttc ttccggagat tattgccacg tctgcagctc tgctcactat cataatcgtc
      421 atgtttttgt cgcatagaga cgagcaattg gacgtcgttg gtgatgttgt aacagtcagg
      481 agtgaatctg gccgcgagca acgacgacaa agaaagttag ccgctataat gtggagtgca
      541 atcggaaatt ctctacgaag attgactaat ttcgtgcttt tcctgttcac ggcatatgtt
      601 ggaatcgtga aaccatcgct gagtaactca atttactttc tcgcttttct gttcatatcc
      661 acgtggtggt ccacatacac accactgaga catggagtgt acaatcagat aaagaagttt
      721 ctcatattct actcggcgct tcatttcttg gttctctaca catatcaaat tccgatcgtt
      781 caccactcat ggctgccgac cggttcattt ctgccacgtc tgttcggact tactgtactc
      841 atggattcat catgtcccga atggtggaag tttccatttg tagctccaga ctttaacgat
      901 gatgatttga ttatgaaatg gccgttgtat gcaaatccga ttgttgtact ggtgttcttc
      961 tacctcacag ttgctcaata caaattcacg agaaacggat ctcgtgaata tatcgatgat
     1021 aacgaatatg ggtcatcagt tcacgaagaa cttctgtcca atgcatcctc ctctgctaat
     1081 gatgatgaac agggtcgagc tcgttcgcga tctccgctgc gaaatggtga agaacaaggc
     1141 tcaatcccac tacggaaagt tacttcgcaa gttgttgata ggaataagtt gagcaacatt
     1201 tttaatacac ccggagataa ggaatctgct gcttcgaaag gaatgattgc agtcatgaca
     1261 tttgtcattt tccattcgta ttcaatcgcg ctgactgcta tgatgacatg ggctctcctc
     1321 tatcattcga tattcggtct cattctcctc atcctcacat gtatcttgtg gatcttccgt
     1381 gatacgagaa agtcatcgtt tgcaatggcc cctattattt tgatgtatat cgagtttcta
     1441 ttgattcttc aatatttcct cagtatggat attcatgcag aaattggcga tccagcgtgg
     1501 atgaactttg ttggaatcga atggactact cttccagtac atgctgtcat cattctctgt
     1561 gtccagactc ttctcactct cccagtgttc ttgcttctac gtttggctcg cagggagaag
     1621 ttttacgaat cgctgagtga ttatgaacga caacgacgaa tcaactcata tggaacattt
     1681 ggagcatcaa agactggagc tgggggtgtt gcagtggcta aggatccaaa aagtcggaag
     1741 ttcgcggcat ttgtggaata tctgtcgaat aaagtgtctg tctacttcat atttgtagta
     1801 tcagtggtac ttttggtggt ctctacgtgt tttgctccga atttctacaa tattctattc
     1861 ttcgcactat gggcattgaa cttgatttat ctcaagttct cattccgtct gtatcgtgga
     1921 ttggcatatg cattctggct aactctcacg ttctacactt caattgttat tatcgccctc
     1981 tacatttatc agttccctgg agtatctcaa tggattattc gaaatactag tttgtcgcag
     2041 gagtggctga atgcaattgg acttgtcgat tttagagcta tcggtgaatc gggagcccta
     2101 tttctacaat tactcgcccc aattgccttg ttcgtcgtca caatgctcca actcaagttt
     2161 ttccatggac catggagtcg agcaacgtca ccaagaagag cagaaaatga tccacctaca
     2221 agtacgacgg aggctgcggc ggtagcaagc acatctggaa cacaaggaag agcacatgct
     2281 gcaggcgata cccttgtcaa gaagctgcac aaattggcaa atcagacaat cgaactgtta
     2341 tggaggtttt tcgaagttca catttcgaaa attgtctttg tcatcattgc gatttttatt
     2401 gccaacaata tcaatgctct atacattcca cttgttattc tcctctcatt ggctatatgt
     2461 ctaccatcag ctgcagatgg gatattctct ttatttatgt gtgcctactt attcctcgtg
     2521 gcactgagca agatgatcta ccaactggat attgttcccg agttatcaca aatcgaccga
     2581 ggagttggag cagataactg ttcacatgga aatatttcaa tgcctgaatg gtttggattg
     2641 aagaaggaag ttgaaggaac tgaaccaatt tatatgctct ttggagtcat tgtttcgatt
     2701 attgcattgg cttttcaatc aattgttata tatcgacaaa gacattatcg agcttcactg
     2761 ggacttcctg aatcgatgcg agctaaagtg ttcccggact tccatcattc tcattttgat
     2821 agatctctca aaaatgccat ccaattcttg atagactatg gtttctataa gtttggactt
     2881 gaaatcacga tgatcgccat tggaattgac attttcaatc gaatggatgc attggcagcg
     2941 attcaatgtt tctggcttgt cctgtttgcg ctcaataaaa gagtctttgt tcgaagaata
     3001 tgggtattct atgtgatcta tatggcgatt ctgtatccac ttcagttctt ttcatatgtt
     3061 ggattaccac ctgacagttg tattgagtat ccatggtcgt attggattcc atcgtatagt
     3121 gatgatgcga gattcaatct gtcgtatctt ctgaacttgt caatatacgg tgtaaactgg
     3181 ccatcagcat atctcattgg cgatttcttc gtactcctct tggcatcatg ccaattagca
     3241 gttttccggc gagaaggaga agataatgat tcaatttaca atgatggaaa ctttgtgatt
     3301 aagccagaaa atccacaata tgactttatt gacaccaaaa agagttacgt tgattatttc
     3361 aaatcattcg ttttccatta tggacactgg attacattga tgtctacact agcagcagga
     3421 attgctggaa cgtcactttt tgctttggga tacattatat tcactctgac aatgctgtgg
     3481 tctggtaaca atttgtatgt gatgaactca actctacgat catttgaaca tactttgaaa
     3541 cgatggaatg cacttttggg atacacattg ttcacgatta caatgaaagt ttgccttcaa
     3601 atatttggat gtgtattcct gtcgtggttc gatcaatctg gtggatgggg aaagactctg
     3661 tgcatcgttc gtcaactctt cagtatcaca tgtgttaata acgaatgtca tgtgctcaaa
     3721 gagctggagg atttctcgaa ggcgtgtgct gttgagacga aagaaggaaa tattggattt
     3781 gatgtgattg cgctatcctt cctcgtcttc caaatccgaa ttttccattc ttggtatttc
     3841 caacactgca tggttgaata tcgaagtgag gttattctgg ccaatagagg tgccgtgctg
     3901 aagaatcaac tgattgaaaa ggaaatgaag gaacaaaacg agcagcaaaa agccaagttc
     3961 aatgatatca gaagaagaac tgaagctatt cgtgaaagat atcaaaaaca aatcgaacga
     4021 ggagctgctg aacgtgactt cgagccggtt acttatgggc acgccaaacg agcgggagac
     4081 tactacatgt tcaaatacga tcctgaaaat gatgatcttg tggaacccgt cgacagtttt
     4141 gtaccagaag ttgatcccaa ggcaactgca tatgatcgac ttgatcctgg acagataatg
     4201 tacgctgcca ccgctcacga cctcgacctc gccaaaactg tacagcaagt caagaaaggc
     4261 gatactatca aagatcctga ttcacgtgct cttatcgctg tttctgaacc agaagctcgt
     4321 aagccaggag gcactgaaga aacggatggt gatgaagatg aggataataa ggattcgaaa
     4381 gtggaaagta ctgctaaatt cattcaaaaa atgatcgctt ctgccttgga cttgtgtagt
     4441 gtaacactaa acaaactgtg cagagaacac cgatatgttg gatttgtttt gagcaaggaa
     4501 aaacaaaagt tgaagtcagg acactcggaa tctctttcaa atacatctag aaagctgacg
     4561 gatattcgat ctgcagttga tctaccaagt cttcaacttg tgcaatcggc gaatgatgtt
     4621 gaaaagatgg agacagccgt cagcgtggat tggcaacaaa aatcatcagc aacgagacta
     4681 ttgaatgcag ttgtgaattg tattggagca cacactgata ttctctgcta cttcttcgca
     4741 attatgacac aagtgatgac tggtggactt attactcttc cacttcctct gatgtcacta
     4801 ttctggggaa atctatcgaa tcctcgtcca tccaagttct tctgggtcac aatgatcacc
     4861 tacactgagt gtgtcattgt tatcaagttt gtttgccaat ttgcattcat gccttacaat
     4921 tctatcacgt ggcgaacaga gcatcaaatg gacccgatgt cattggataa gttattcgga
     4981 gtatcacaga gagatagttt tgcactttgg gacattgttt tgctcttctc actcttcttc
     5041 catcggtata tgctcagaaa gttagggtta tggaaggatg ccaatttgac ggacacgttc
     5101 actttgaagg aagagcctcg atcggcgtca ggatcggaca caggatcacc caagaaaatt
     5161 gctcaagagc caaaggttgt tgtaactcag tcagataccc ttgaaggtac aagtggagga
     5221 gagatagtca taccatctga tccaaatgca gtttccaata tggaagaatt agactgcgaa
     5281 cctccgattc cagagaagca aagtggacca attggaagat tcattcatca attattccat
     5341 ccaaaattcc gttacattcg tgatttgtat ccaataatgt ttggaatcga tgtgatatgc
     5401 ttcctcatca tgacatttgg atactcggca tttggtgaag gaggttctgg aaatgtttta
     5461 gatgatgtga aggcttctcg tattccggta acacttgttg ttatgctcgt tggaatgact
     5521 ctggcaatta tcattgatcg agcactctac ctcagaaaat cagttgtcgg aaagctaatc
     5581 tatcaagtct taatgattgc tttccttcac atttgggtat tccttgttct tccaaatatg
     5641 actcgtcgtt ctgcgatatc gaatcacgtt gctcaagcat tgtacgtcat caaatcgtgc
     5701 tatttccttg tgtctgcttg gcagatccga aatggttatc ctgaactttg tattggaaat
     5761 ctattaacac attcatacgg aatgaccaat atgattgcat tcaaagtatt catgaatatt
     5821 ccattcctct tcgagcttcg tacagctatt gattggacat ggacagatac ttcaatgcct
     5881 cttttcgatt tcttcaatat ggaaaatttc tatgctcata tattcaatat caagtgtgcc
     5941 cgccagttcg aagctgccta tccagctcca agagggattc ccaaaggaaa gttggtcaag
     6001 tatatgatgg gattcccaat tatcattgga gtcgttatct tcatcttttc tcctctattg
     6061 ctctggtcgc tactcaatca aatcggaact atcagtatgc cagaaaaagt tacgttgagg
     6121 atttcgattg aaggatatcc accactttac gagatggagg cacaaggaag taatcacgat
     6181 aacgctgaac ttggaatgat aaaacctgat caattggcat ctttgaatca agcattgacg
     6241 gatagttaca cgacacgaga cactaattct attttaagat caagaatgtc tgtatcatat
     6301 ctgaaaggat acacatatga ggatattctg attgtgcgat tccgtccaga atctgaaatt
     6361 tattggccga tttcacagga ttcgagaaat gcgatgatcg ataaattgag ccgaaacacg
     6421 tcagtcaatt ttgaagtatc tctggaattc actcggccat atgatccaaa tgaaaacgct
     6481 gctttaaaac attcgaaatc gtggcttgtt ccaatctccc tggatatgac gattcgagca
     6541 aaaattcaaa gtgctctccg aggagatcca ggtcatccga ttctcattcc acagtcaatt
     6601 cctgcgttta ttcaagttcc aaatcaagga gaattgaccc ttccaacatc aatcggaaat
     6661 actattatca atgacggaaa tccacggatt aatacgaccg ggatggaaaa atcagacgaa
     6721 gctcgggctt ggttcgactc gttaaccttg aatctcgaac aaggaaaatc gcaaaacgag
     6781 aaaatgtgga tcgccacatc cgaacatcca ggagaccaaa atgcgaaact ctggataaag
     6841 actgcaaata cgacgtattc gggaaggccg taccttcaag ttgtcggatt tattgataga
     6901 gcattcccat catttttggc gaaagttttc aaaggaggag tcattgcagt gtatctttca
     6961 gttatcctcg tcgttggaag aggtctggtt cgtggaatct tcaccacatc tccaagcact
     7021 gtcatgttca cagaattacc gaatgcggat catcttctca aaatttgtct cgacatctat
     7081 ttggttcgag aagcgaagga cttcatgttg gagcaggatc tcttcgccaa attaatattc
     7141 ctgttccgat caccagcgac actcatcgaa tggacacgaa tgagcaaaaa gaagcaagaa
     7201 taa
//