Dbfetch

LOCUS       NM_001268460            7317 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001268460
VERSION     NM_001268460.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 7317)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 7317)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7317)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 7317)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Apr 20, 2015 this sequence version replaced NM_001268460.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..7317
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>7317
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..7317
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1a"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001255389.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1a"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:Q17897"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:Q17897"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MTVPPLLKSCVVKLLLPAALLAAAIIRPSFLSIGYVLLALVSAV
                     LPPIRKSLALPKLVGTFVIITFLFCLAVALGVGSYQISEQVVHKNDRTYICNRSDTTL
                     FRSIGLVRFHPTGTFESTRAFLPEIIATSAALLTIIIVMFLSHRDEQLDVVGDVVTVR
                     SESGREQRRQRKLAAIMWSAIGNSLRRLTNFVLFLFTAYVGIVKPSLSNSIYFLAFLF
                     ISTWWSTYTPLRHGVYNQIKKFLIFYSALHFLVLYTYQIPIVHHSWLPTGSFLPRLFG
                     LTVLMDSSCPEWWKFPFVAPDFNDDDLIMKWPLYANPIVVLVFFYLTVAQYKFTRNGS
                     REYIDDNEYGSSVHEERFVSAGTVETNVDDVGQLISISESTASAPSGRGRGNTLLLSN
                     ASSSANDDEQGRARSRSPLRNGEEQGSIPLRKVTSQVVDRNKLSNIFNTPGDKESAAS
                     KGMIAVMTFVIFHSYSIALTAMMTWALLYHSIFGLILLILTCILWIFRDTRKSSFAMA
                     PIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGIEWTTLPVHAVIILCVQTLLTLP
                     VFLLLRLARREKFYESLSDYERQRRINSYGTFGASKTGAGGVAVAKDPKSRKFAAFVE
                     YLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILFFALWALNLIYLKFSFRLYRGLAYA
                     FWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSLSQEWLNAIGLVDFRAIGESGALFL
                     QLLAPIALFVVTMLQLKFFHGPWSRATSPRRAENDPPTSTTEAAAVASTSGTQGRAHA
                     AGDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVILLSLA
                     ICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPELSQIDRGVGADNCSHGNISMPE
                     WFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKVFPDF
                     HHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVLFALN
                     KRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFNLSYL
                     LNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREGEDNDSIYNDGNFVIKPENPQYD
                     FIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLY
                     VMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVR
                     QLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSWYFQH
                     CMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQKQIER
                     GAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLVEPVDSFVPEVDPKATAYDRLDPGQ
                     IMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALIAVSEPEARKPGGTEETDGDEDEDN
                     KDSKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSN
                     TSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHT
                     DILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKF
                     VCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKL
                     GLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPS
                     DPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIM
                     TFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQ
                     VLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGN
                     LLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIK
                     CARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEK
                     VTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRS
                     RMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEFTR
                     PYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQG
                     ELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSE
                     HPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVG
                     RGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRS
                     PATLIEWTRMSKKKQE"
     STS             2681..3556
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             4579..5612
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgacggtcc cgccgctttt aaaatcgtgc gtcgtcaaat tgctgcttcc ggcagcactg
       61 cttgcagctg ccataatccg gccgagcttt ttatcaattg gctacgtcct acttgcactt
      121 gtcagcgccg ttctgccacc aattcgaaag tctttagcac ttcccaaact agttggaaca
      181 ttcgttatta tcacttttct cttctgccta gcagtcgcac taggagttgg ttcctaccag
      241 atctcagaac aagttgttca taaaaatgac cggacataca tttgcaatcg atccgacact
      301 actctgttcc ggagcattgg ccttgtccga ttccatccaa caggaacatt tgaatcaact
      361 cgagcatttc ttccggagat tattgccacg tctgcagctc tgctcactat cataatcgtc
      421 atgtttttgt cgcatagaga cgagcaattg gacgtcgttg gtgatgttgt aacagtcagg
      481 agtgaatctg gccgcgagca acgacgacaa agaaagttag ccgctataat gtggagtgca
      541 atcggaaatt ctctacgaag attgactaat ttcgtgcttt tcctgttcac ggcatatgtt
      601 ggaatcgtga aaccatcgct gagtaactca atttactttc tcgcttttct gttcatatcc
      661 acgtggtggt ccacatacac accactgaga catggagtgt acaatcagat aaagaagttt
      721 ctcatattct actcggcgct tcatttcttg gttctctaca catatcaaat tccgatcgtt
      781 caccactcat ggctgccgac cggttcattt ctgccacgtc tgttcggact tactgtactc
      841 atggattcat catgtcccga atggtggaag tttccatttg tagctccaga ctttaacgat
      901 gatgatttga ttatgaaatg gccgttgtat gcaaatccga ttgttgtact ggtgttcttc
      961 tacctcacag ttgctcaata caaattcacg agaaacggat ctcgtgaata tatcgatgat
     1021 aacgaatatg ggtcatcagt tcacgaagaa cgttttgtct ccgccggcac tgtcgaaacg
     1081 aatgtggacg acgtgggtca gctcatttca atttctgaga gcacagcttc tgctccatct
     1141 ggcagaggac gtggaaatac tttgcttctg tccaatgcat cctcctctgc taatgatgat
     1201 gaacagggtc gagctcgttc gcgatctccg ctgcgaaatg gtgaagaaca aggctcaatc
     1261 ccactacgga aagttacttc gcaagttgtt gataggaata agttgagcaa catttttaat
     1321 acacccggag ataaggaatc tgctgcttcg aaaggaatga ttgcagtcat gacatttgtc
     1381 attttccatt cgtattcaat cgcgctgact gctatgatga catgggctct cctctatcat
     1441 tcgatattcg gtctcattct cctcatcctc acatgtatct tgtggatctt ccgtgatacg
     1501 agaaagtcat cgtttgcaat ggcccctatt attttgatgt atatcgagtt tctattgatt
     1561 cttcaatatt tcctcagtat ggatattcat gcagaaattg gcgatccagc gtggatgaac
     1621 tttgttggaa tcgaatggac tactcttcca gtacatgctg tcatcattct ctgtgtccag
     1681 actcttctca ctctcccagt gttcttgctt ctacgtttgg ctcgcaggga gaagttttac
     1741 gaatcgctga gtgattatga acgacaacga cgaatcaact catatggaac atttggagca
     1801 tcaaagactg gagctggggg tgttgcagtg gctaaggatc caaaaagtcg gaagttcgcg
     1861 gcatttgtgg aatatctgtc gaataaagtg tctgtctact tcatatttgt agtatcagtg
     1921 gtacttttgg tggtctctac gtgttttgct ccgaatttct acaatattct attcttcgca
     1981 ctatgggcat tgaacttgat ttatctcaag ttctcattcc gtctgtatcg tggattggca
     2041 tatgcattct ggctaactct cacgttctac acttcaattg ttattatcgc cctctacatt
     2101 tatcagttcc ctggagtatc tcaatggatt attcgaaata ctagtttgtc gcaggagtgg
     2161 ctgaatgcaa ttggacttgt cgattttaga gctatcggtg aatcgggagc cctatttcta
     2221 caattactcg ccccaattgc cttgttcgtc gtcacaatgc tccaactcaa gtttttccat
     2281 ggaccatgga gtcgagcaac gtcaccaaga agagcagaaa atgatccacc tacaagtacg
     2341 acggaggctg cggcggtagc aagcacatct ggaacacaag gaagagcaca tgctgcaggc
     2401 gatacccttg tcaagaagct gcacaaattg gcaaatcaga caatcgaact gttatggagg
     2461 tttttcgaag ttcacatttc gaaaattgtc tttgtcatca ttgcgatttt tattgccaac
     2521 aatatcaatg ctctatacat tccacttgtt attctcctct cattggctat atgtctacca
     2581 tcagctgcag atgggatatt ctctttattt atgtgtgcct acttattcct cgtggcactg
     2641 agcaagatga tctaccaact ggatattgtt cccgagttat cacaaatcga ccgaggagtt
     2701 ggagcagata actgttcaca tggaaatatt tcaatgcctg aatggtttgg attgaagaag
     2761 gaagttgaag gaactgaacc aatttatatg ctctttggag tcattgtttc gattattgca
     2821 ttggcttttc aatcaattgt tatatatcga caaagacatt atcgagcttc actgggactt
     2881 cctgaatcga tgcgagctaa agtgttcccg gacttccatc attctcattt tgatagatct
     2941 ctcaaaaatg ccatccaatt cttgatagac tatggtttct ataagtttgg acttgaaatc
     3001 acgatgatcg ccattggaat tgacattttc aatcgaatgg atgcattggc agcgattcaa
     3061 tgtttctggc ttgtcctgtt tgcgctcaat aaaagagtct ttgttcgaag aatatgggta
     3121 ttctatgtga tctatatggc gattctgtat ccacttcagt tcttttcata tgttggatta
     3181 ccacctgaca gttgtattga gtatccatgg tcgtattgga ttccatcgta tagtgatgat
     3241 gcgagattca atctgtcgta tcttctgaac ttgtcaatat acggtgtaaa ctggccatca
     3301 gcatatctca ttggcgattt cttcgtactc ctcttggcat catgccaatt agcagttttc
     3361 cggcgagaag gagaagataa tgattcaatt tacaatgatg gaaactttgt gattaagcca
     3421 gaaaatccac aatatgactt tattgacacc aaaaagagtt acgttgatta tttcaaatca
     3481 ttcgttttcc attatggaca ctggattaca ttgatgtcta cactagcagc aggaattgct
     3541 ggaacgtcac tttttgcttt gggatacatt atattcactc tgacaatgct gtggtctggt
     3601 aacaatttgt atgtgatgaa ctcaactcta cgatcatttg aacatacttt gaaacgatgg
     3661 aatgcacttt tgggatacac attgttcacg attacaatga aagtttgcct tcaaatattt
     3721 ggatgtgtat tcctgtcgtg gttcgatcaa tctggtggat ggggaaagac tctgtgcatc
     3781 gttcgtcaac tcttcagtat cacatgtgtt aataacgaat gtcatgtgct caaagagctg
     3841 gaggatttct cgaaggcgtg tgctgttgag acgaaagaag gaaatattgg atttgatgtg
     3901 attgcgctat ccttcctcgt cttccaaatc cgaattttcc attcttggta tttccaacac
     3961 tgcatggttg aatatcgaag tgaggttatt ctggccaata gaggtgccgt gctgaagaat
     4021 caactgattg aaaaggaaat gaaggaacaa aacgagcagc aaaaagccaa gttcaatgat
     4081 atcagaagaa gaactgaagc tattcgtgaa agatatcaaa aacaaatcga acgaggagct
     4141 gctgaacgtg acttcgagcc ggttacttat gggcacgcca aacgagcggg agactactac
     4201 atgttcaaat acgatcctga aaatgatgat cttgtggaac ccgtcgacag ttttgtacca
     4261 gaagttgatc ccaaggcaac tgcatatgat cgacttgatc ctggacagat aatgtacgct
     4321 gccaccgctc acgacctcga cctcgccaaa actgtacagc aagtcaagaa aggcgatact
     4381 atcaaagatc ctgattcacg tgctcttatc gctgtttctg aaccagaagc tcgtaagcca
     4441 ggaggcactg aagaaacgga tggtgatgaa gatgaggata ataaggattc gaaagtggaa
     4501 agtactgcta aattcattca aaaaatgatc gcttctgcct tggacttgtg tagtgtaaca
     4561 ctaaacaaac tgtgcagaga acaccgatat gttggatttg ttttgagcaa ggaaaaacaa
     4621 aagttgaagt caggacactc ggaatctctt tcaaatacat ctagaaagct gacggatatt
     4681 cgatctgcag ttgatctacc aagtcttcaa cttgtgcaat cggcgaatga tgttgaaaag
     4741 atggagacag ccgtcagcgt ggattggcaa caaaaatcat cagcaacgag actattgaat
     4801 gcagttgtga attgtattgg agcacacact gatattctct gctacttctt cgcaattatg
     4861 acacaagtga tgactggtgg acttattact cttccacttc ctctgatgtc actattctgg
     4921 ggaaatctat cgaatcctcg tccatccaag ttcttctggg tcacaatgat cacctacact
     4981 gagtgtgtca ttgttatcaa gtttgtttgc caatttgcat tcatgcctta caattctatc
     5041 acgtggcgaa cagagcatca aatggacccg atgtcattgg ataagttatt cggagtatca
     5101 cagagagata gttttgcact ttgggacatt gttttgctct tctcactctt cttccatcgg
     5161 tatatgctca gaaagttagg gttatggaag gatgccaatt tgacggacac gttcactttg
     5221 aaggaagagc ctcgatcggc gtcaggatcg gacacaggat cacccaagaa aattgctcaa
     5281 gagccaaagg ttgttgtaac tcagtcagat acccttgaag gtacaagtgg aggagagata
     5341 gtcataccat ctgatccaaa tgcagtttcc aatatggaag aattagactg cgaacctccg
     5401 attccagaga agcaaagtgg accaattgga agattcattc atcaattatt ccatccaaaa
     5461 ttccgttaca ttcgtgattt gtatccaata atgtttggaa tcgatgtgat atgcttcctc
     5521 atcatgacat ttggatactc ggcatttggt gaaggaggtt ctggaaatgt tttagatgat
     5581 gtgaaggctt ctcgtattcc ggtaacactt gttgttatgc tcgttggaat gactctggca
     5641 attatcattg atcgagcact ctacctcaga aaatcagttg tcggaaagct aatctatcaa
     5701 gtcttaatga ttgctttcct tcacatttgg gtattccttg ttcttccaaa tatgactcgt
     5761 cgttctgcga tatcgaatca cgttgctcaa gcattgtacg tcatcaaatc gtgctatttc
     5821 cttgtgtctg cttggcagat ccgaaatggt tatcctgaac tttgtattgg aaatctatta
     5881 acacattcat acggaatgac caatatgatt gcattcaaag tattcatgaa tattccattc
     5941 ctcttcgagc ttcgtacagc tattgattgg acatggacag atacttcaat gcctcttttc
     6001 gatttcttca atatggaaaa tttctatgct catatattca atatcaagtg tgcccgccag
     6061 ttcgaagctg cctatccagc tccaagaggg attcccaaag gaaagttggt caagtatatg
     6121 atgggattcc caattatcat tggagtcgtt atcttcatct tttctcctct attgctctgg
     6181 tcgctactca atcaaatcgg aactatcagt atgccagaaa aagttacgtt gaggatttcg
     6241 attgaaggat atccaccact ttacgagatg gaggcacaag gaagtaatca cgataacgct
     6301 gaacttggaa tgataaaacc tgatcaattg gcatctttga atcaagcatt gacggatagt
     6361 tacacgacac gagacactaa ttctatttta agatcaagaa tgtctgtatc atatctgaaa
     6421 ggatacacat atgaggatat tctgattgtg cgattccgtc cagaatctga aatttattgg
     6481 ccgatttcac aggattcgag aaatgcgatg atcgataaat tgagccgaaa cacgtcagtc
     6541 aattttgaag tatctctgga attcactcgg ccatatgatc caaatgaaaa cgctgcttta
     6601 aaacattcga aatcgtggct tgttccaatc tccctggata tgacgattcg agcaaaaatt
     6661 caaagtgctc tccgaggaga tccaggtcat ccgattctca ttccacagtc aattcctgcg
     6721 tttattcaag ttccaaatca aggagaattg acccttccaa catcaatcgg aaatactatt
     6781 atcaatgacg gaaatccacg gattaatacg accgggatgg aaaaatcaga cgaagctcgg
     6841 gcttggttcg actcgttaac cttgaatctc gaacaaggaa aatcgcaaaa cgagaaaatg
     6901 tggatcgcca catccgaaca tccaggagac caaaatgcga aactctggat aaagactgca
     6961 aatacgacgt attcgggaag gccgtacctt caagttgtcg gatttattga tagagcattc
     7021 ccatcatttt tggcgaaagt tttcaaagga ggagtcattg cagtgtatct ttcagttatc
     7081 ctcgtcgttg gaagaggtct ggttcgtgga atcttcacca catctccaag cactgtcatg
     7141 ttcacagaat taccgaatgc ggatcatctt ctcaaaattt gtctcgacat ctatttggtt
     7201 cgagaagcga aggacttcat gttggagcag gatctcttcg ccaaattaat attcctgttc
     7261 cgatcaccag cgacactcat cgaatggaca cgaatgagca aaaagaagca agaataa
//