Dbfetch

LOCUS       NM_001268459            7209 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001268459
VERSION     NM_001268459.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 7209)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 7209)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7209)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 7209)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Apr 20, 2015 this sequence version replaced NM_001268459.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..7209
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>7209
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..7209
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1d"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001255388.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1d"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:H9G2S2"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:H9G2S2"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MTVPPLLKSCVVKLLLPAALLAAAIIRPSFLSIGYVLLALVSAV
                     LPPIRKSLALPKLVGTFVIITFLFCLAVALGVGSYQISEQVVHKNDRTYICNRSDTTL
                     FRSIGLVRFHPTGTFESTRAFLPEIIATSAALLTIIIVMFLSHRDEQLDVVGDVVTVR
                     SESGREQRRQRKLAAIMWSAIGNSLRRLTNFVLFLFTAYVGIVKPSLSNSIYFLAFLF
                     ISTWWSTYTPLRHGVYNQIKKFLIFYSALHFLVLYTYQIPIVHHSWLPTGSFLPRLFG
                     LTVLMDSSCPEWWKFPFVAPDFNDDDLIMKWPLYANPIVVLVFFYLTVAQYKFTRNGS
                     REYIDDNEYGSSVHEELLSNASSSANDDEQGRARSRSPLRNGEEQGSIPLRKVTSQVV
                     DRNKLSNIFNTTAPGDKESAASKGMIAVMTFVIFHSYSIALTAMMTWALLYHSIFGLI
                     LLILTCILWIFRDTRKSSFAMAPIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGI
                     EWTTLPVHAVIILCVQTLLTLPVFLLLRLARREKFYESLSDYERQRRINSYGTFGASK
                     TGAGGVAVAKDPKSRKFAAFVEYLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILFFA
                     LWALNLIYLKFSFRLYRGLAYAFWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSLSQ
                     EWLNAIGLVDFRAIGESGALFLQLLAPIALFVVTMLQLKFFHGPWSRATSPRRAENDP
                     PTSTTEAAAVASTSGTQGRAHAAGDTLVKKLHKLANQTIELLWRFFEVHISKIVFVII
                     AIFIANNINALYIPLVILLSLAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPE
                     LSQIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYR
                     QRHYRASLGLPESMRAKVFPDFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGID
                     IFNRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCI
                     EYPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREG
                     EDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGT
                     SLFALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIF
                     GCVFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGF
                     DVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKA
                     KFNDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLVEP
                     VDSFVPEVDPKATAYDRLDPGQIMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALIAV
                     SEPEARKPGGTEETDGDEDEDNKDSKVESTAKFIQKMIASALDLCSVTLNKLCREHRY
                     VGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVSVD
                     WQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNP
                     RPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDS
                     FALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEP
                     KVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPK
                     FRYIRDLYPIMFGIDVICFLIMTFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVGMT
                     LAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIK
                     SCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTD
                     TSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIF
                     IFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQL
                     ASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRN
                     AMIDKLSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRG
                     DPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFD
                     SLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPS
                     FLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLV
                     REAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE"
     STS             2573..3448
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             4471..5504
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgacggtcc cgccgctttt aaaatcgtgc gtcgtcaaat tgctgcttcc ggcagcactg
       61 cttgcagctg ccataatccg gccgagcttt ttatcaattg gctacgtcct acttgcactt
      121 gtcagcgccg ttctgccacc aattcgaaag tctttagcac ttcccaaact agttggaaca
      181 ttcgttatta tcacttttct cttctgccta gcagtcgcac taggagttgg ttcctaccag
      241 atctcagaac aagttgttca taaaaatgac cggacataca tttgcaatcg atccgacact
      301 actctgttcc ggagcattgg ccttgtccga ttccatccaa caggaacatt tgaatcaact
      361 cgagcatttc ttccggagat tattgccacg tctgcagctc tgctcactat cataatcgtc
      421 atgtttttgt cgcatagaga cgagcaattg gacgtcgttg gtgatgttgt aacagtcagg
      481 agtgaatctg gccgcgagca acgacgacaa agaaagttag ccgctataat gtggagtgca
      541 atcggaaatt ctctacgaag attgactaat ttcgtgcttt tcctgttcac ggcatatgtt
      601 ggaatcgtga aaccatcgct gagtaactca atttactttc tcgcttttct gttcatatcc
      661 acgtggtggt ccacatacac accactgaga catggagtgt acaatcagat aaagaagttt
      721 ctcatattct actcggcgct tcatttcttg gttctctaca catatcaaat tccgatcgtt
      781 caccactcat ggctgccgac cggttcattt ctgccacgtc tgttcggact tactgtactc
      841 atggattcat catgtcccga atggtggaag tttccatttg tagctccaga ctttaacgat
      901 gatgatttga ttatgaaatg gccgttgtat gcaaatccga ttgttgtact ggtgttcttc
      961 tacctcacag ttgctcaata caaattcacg agaaacggat ctcgtgaata tatcgatgat
     1021 aacgaatatg ggtcatcagt tcacgaagaa cttctgtcca atgcatcctc ctctgctaat
     1081 gatgatgaac agggtcgagc tcgttcgcga tctccgctgc gaaatggtga agaacaaggc
     1141 tcaatcccac tacggaaagt tacttcgcaa gttgttgata ggaataagtt gagcaacatt
     1201 tttaatacta cagcacccgg agataaggaa tctgctgctt cgaaaggaat gattgcagtc
     1261 atgacatttg tcattttcca ttcgtattca atcgcgctga ctgctatgat gacatgggct
     1321 ctcctctatc attcgatatt cggtctcatt ctcctcatcc tcacatgtat cttgtggatc
     1381 ttccgtgata cgagaaagtc atcgtttgca atggccccta ttattttgat gtatatcgag
     1441 tttctattga ttcttcaata tttcctcagt atggatattc atgcagaaat tggcgatcca
     1501 gcgtggatga actttgttgg aatcgaatgg actactcttc cagtacatgc tgtcatcatt
     1561 ctctgtgtcc agactcttct cactctccca gtgttcttgc ttctacgttt ggctcgcagg
     1621 gagaagtttt acgaatcgct gagtgattat gaacgacaac gacgaatcaa ctcatatgga
     1681 acatttggag catcaaagac tggagctggg ggtgttgcag tggctaagga tccaaaaagt
     1741 cggaagttcg cggcatttgt ggaatatctg tcgaataaag tgtctgtcta cttcatattt
     1801 gtagtatcag tggtactttt ggtggtctct acgtgttttg ctccgaattt ctacaatatt
     1861 ctattcttcg cactatgggc attgaacttg atttatctca agttctcatt ccgtctgtat
     1921 cgtggattgg catatgcatt ctggctaact ctcacgttct acacttcaat tgttattatc
     1981 gccctctaca tttatcagtt ccctggagta tctcaatgga ttattcgaaa tactagtttg
     2041 tcgcaggagt ggctgaatgc aattggactt gtcgatttta gagctatcgg tgaatcggga
     2101 gccctatttc tacaattact cgccccaatt gccttgttcg tcgtcacaat gctccaactc
     2161 aagtttttcc atggaccatg gagtcgagca acgtcaccaa gaagagcaga aaatgatcca
     2221 cctacaagta cgacggaggc tgcggcggta gcaagcacat ctggaacaca aggaagagca
     2281 catgctgcag gcgataccct tgtcaagaag ctgcacaaat tggcaaatca gacaatcgaa
     2341 ctgttatgga ggtttttcga agttcacatt tcgaaaattg tctttgtcat cattgcgatt
     2401 tttattgcca acaatatcaa tgctctatac attccacttg ttattctcct ctcattggct
     2461 atatgtctac catcagctgc agatgggata ttctctttat ttatgtgtgc ctacttattc
     2521 ctcgtggcac tgagcaagat gatctaccaa ctggatattg ttcccgagtt atcacaaatc
     2581 gaccgaggag ttggagcaga taactgttca catggaaata tttcaatgcc tgaatggttt
     2641 ggattgaaga aggaagttga aggaactgaa ccaatttata tgctctttgg agtcattgtt
     2701 tcgattattg cattggcttt tcaatcaatt gttatatatc gacaaagaca ttatcgagct
     2761 tcactgggac ttcctgaatc gatgcgagct aaagtgttcc cggacttcca tcattctcat
     2821 tttgatagat ctctcaaaaa tgccatccaa ttcttgatag actatggttt ctataagttt
     2881 ggacttgaaa tcacgatgat cgccattgga attgacattt tcaatcgaat ggatgcattg
     2941 gcagcgattc aatgtttctg gcttgtcctg tttgcgctca ataaaagagt ctttgttcga
     3001 agaatatggg tattctatgt gatctatatg gcgattctgt atccacttca gttcttttca
     3061 tatgttggat taccacctga cagttgtatt gagtatccat ggtcgtattg gattccatcg
     3121 tatagtgatg atgcgagatt caatctgtcg tatcttctga acttgtcaat atacggtgta
     3181 aactggccat cagcatatct cattggcgat ttcttcgtac tcctcttggc atcatgccaa
     3241 ttagcagttt tccggcgaga aggagaagat aatgattcaa tttacaatga tggaaacttt
     3301 gtgattaagc cagaaaatcc acaatatgac tttattgaca ccaaaaagag ttacgttgat
     3361 tatttcaaat cattcgtttt ccattatgga cactggatta cattgatgtc tacactagca
     3421 gcaggaattg ctggaacgtc actttttgct ttgggataca ttatattcac tctgacaatg
     3481 ctgtggtctg gtaacaattt gtatgtgatg aactcaactc tacgatcatt tgaacatact
     3541 ttgaaacgat ggaatgcact tttgggatac acattgttca cgattacaat gaaagtttgc
     3601 cttcaaatat ttggatgtgt attcctgtcg tggttcgatc aatctggtgg atggggaaag
     3661 actctgtgca tcgttcgtca actcttcagt atcacatgtg ttaataacga atgtcatgtg
     3721 ctcaaagagc tggaggattt ctcgaaggcg tgtgctgttg agacgaaaga aggaaatatt
     3781 ggatttgatg tgattgcgct atccttcctc gtcttccaaa tccgaatttt ccattcttgg
     3841 tatttccaac actgcatggt tgaatatcga agtgaggtta ttctggccaa tagaggtgcc
     3901 gtgctgaaga atcaactgat tgaaaaggaa atgaaggaac aaaacgagca gcaaaaagcc
     3961 aagttcaatg atatcagaag aagaactgaa gctattcgtg aaagatatca aaaacaaatc
     4021 gaacgaggag ctgctgaacg tgacttcgag ccggttactt atgggcacgc caaacgagcg
     4081 ggagactact acatgttcaa atacgatcct gaaaatgatg atcttgtgga acccgtcgac
     4141 agttttgtac cagaagttga tcccaaggca actgcatatg atcgacttga tcctggacag
     4201 ataatgtacg ctgccaccgc tcacgacctc gacctcgcca aaactgtaca gcaagtcaag
     4261 aaaggcgata ctatcaaaga tcctgattca cgtgctctta tcgctgtttc tgaaccagaa
     4321 gctcgtaagc caggaggcac tgaagaaacg gatggtgatg aagatgagga taataaggat
     4381 tcgaaagtgg aaagtactgc taaattcatt caaaaaatga tcgcttctgc cttggacttg
     4441 tgtagtgtaa cactaaacaa actgtgcaga gaacaccgat atgttggatt tgttttgagc
     4501 aaggaaaaac aaaagttgaa gtcaggacac tcggaatctc tttcaaatac atctagaaag
     4561 ctgacggata ttcgatctgc agttgatcta ccaagtcttc aacttgtgca atcggcgaat
     4621 gatgttgaaa agatggagac agccgtcagc gtggattggc aacaaaaatc atcagcaacg
     4681 agactattga atgcagttgt gaattgtatt ggagcacaca ctgatattct ctgctacttc
     4741 ttcgcaatta tgacacaagt gatgactggt ggacttatta ctcttccact tcctctgatg
     4801 tcactattct ggggaaatct atcgaatcct cgtccatcca agttcttctg ggtcacaatg
     4861 atcacctaca ctgagtgtgt cattgttatc aagtttgttt gccaatttgc attcatgcct
     4921 tacaattcta tcacgtggcg aacagagcat caaatggacc cgatgtcatt ggataagtta
     4981 ttcggagtat cacagagaga tagttttgca ctttgggaca ttgttttgct cttctcactc
     5041 ttcttccatc ggtatatgct cagaaagtta gggttatgga aggatgccaa tttgacggac
     5101 acgttcactt tgaaggaaga gcctcgatcg gcgtcaggat cggacacagg atcacccaag
     5161 aaaattgctc aagagccaaa ggttgttgta actcagtcag atacccttga aggtacaagt
     5221 ggaggagaga tagtcatacc atctgatcca aatgcagttt ccaatatgga agaattagac
     5281 tgcgaacctc cgattccaga gaagcaaagt ggaccaattg gaagattcat tcatcaatta
     5341 ttccatccaa aattccgtta cattcgtgat ttgtatccaa taatgtttgg aatcgatgtg
     5401 atatgcttcc tcatcatgac atttggatac tcggcatttg gtgaaggagg ttctggaaat
     5461 gttttagatg atgtgaaggc ttctcgtatt ccggtaacac ttgttgttat gctcgttgga
     5521 atgactctgg caattatcat tgatcgagca ctctacctca gaaaatcagt tgtcggaaag
     5581 ctaatctatc aagtcttaat gattgctttc cttcacattt gggtattcct tgttcttcca
     5641 aatatgactc gtcgttctgc gatatcgaat cacgttgctc aagcattgta cgtcatcaaa
     5701 tcgtgctatt tccttgtgtc tgcttggcag atccgaaatg gttatcctga actttgtatt
     5761 ggaaatctat taacacattc atacggaatg accaatatga ttgcattcaa agtattcatg
     5821 aatattccat tcctcttcga gcttcgtaca gctattgatt ggacatggac agatacttca
     5881 atgcctcttt tcgatttctt caatatggaa aatttctatg ctcatatatt caatatcaag
     5941 tgtgcccgcc agttcgaagc tgcctatcca gctccaagag ggattcccaa aggaaagttg
     6001 gtcaagtata tgatgggatt cccaattatc attggagtcg ttatcttcat cttttctcct
     6061 ctattgctct ggtcgctact caatcaaatc ggaactatca gtatgccaga aaaagttacg
     6121 ttgaggattt cgattgaagg atatccacca ctttacgaga tggaggcaca aggaagtaat
     6181 cacgataacg ctgaacttgg aatgataaaa cctgatcaat tggcatcttt gaatcaagca
     6241 ttgacggata gttacacgac acgagacact aattctattt taagatcaag aatgtctgta
     6301 tcatatctga aaggatacac atatgaggat attctgattg tgcgattccg tccagaatct
     6361 gaaatttatt ggccgatttc acaggattcg agaaatgcga tgatcgataa attgagccga
     6421 aacacgtcag tcaattttga agtatctctg gaattcactc ggccatatga tccaaatgaa
     6481 aacgctgctt taaaacattc gaaatcgtgg cttgttccaa tctccctgga tatgacgatt
     6541 cgagcaaaaa ttcaaagtgc tctccgagga gatccaggtc atccgattct cattccacag
     6601 tcaattcctg cgtttattca agttccaaat caaggagaat tgacccttcc aacatcaatc
     6661 ggaaatacta ttatcaatga cggaaatcca cggattaata cgaccgggat ggaaaaatca
     6721 gacgaagctc gggcttggtt cgactcgtta accttgaatc tcgaacaagg aaaatcgcaa
     6781 aacgagaaaa tgtggatcgc cacatccgaa catccaggag accaaaatgc gaaactctgg
     6841 ataaagactg caaatacgac gtattcggga aggccgtacc ttcaagttgt cggatttatt
     6901 gatagagcat tcccatcatt tttggcgaaa gttttcaaag gaggagtcat tgcagtgtat
     6961 ctttcagtta tcctcgtcgt tggaagaggt ctggttcgtg gaatcttcac cacatctcca
     7021 agcactgtca tgttcacaga attaccgaat gcggatcatc ttctcaaaat ttgtctcgac
     7081 atctatttgg ttcgagaagc gaaggacttc atgttggagc aggatctctt cgccaaatta
     7141 atattcctgt tccgatcacc agcgacactc atcgaatgga cacgaatgag caaaaagaag
     7201 caagaataa
//