Dbfetch

LOCUS       NM_001268458            7323 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001268458
VERSION     NM_001268458.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 7323)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 7323)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7323)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 7323)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Apr 20, 2015 this sequence version replaced NM_001268458.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..7323
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>7323
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..7323
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1c"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001255387.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1c"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:D0VWN8"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:D0VWN8"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MTVPPLLKSCVVKLLLPAALLAAAIIRPSFLSIGYVLLALVSAV
                     LPPIRKSLALPKLVGTFVIITFLFCLAVALGVGSYQISEQVVHKNDRTYICNRSDTTL
                     FRSIGLVRFHPTGTFESTRAFLPEIIATSAALLTIIIVMFLSHRDEQLDVVGDVVTVR
                     SESGREQRRQRKLAAIMWSAIGNSLRRLTNFVLFLFTAYVGIVKPSLSNSIYFLAFLF
                     ISTWWSTYTPLRHGVYNQIKKFLIFYSALHFLVLYTYQIPIVHHSWLPTGSFLPRLFG
                     LTVLMDSSCPEWWKFPFVAPDFNDDDLIMKWPLYANPIVVLVFFYLTVAQYKFTRNGS
                     REYIDDNEYGSSVHEERFVSAGTVETNVDDVGQLISISESTASAPSGRGRGNTLLLSN
                     ASSSANDDEQGRARSRSPLRNGEEQGSIPLRKVTSQVVDRNKLSNIFNTTAPGDKESA
                     ASKGMIAVMTFVIFHSYSIALTAMMTWALLYHSIFGLILLILTCILWIFRDTRKSSFA
                     MAPIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGIEWTTLPVHAVIILCVQTLLT
                     LPVFLLLRLARREKFYESLSDYERQRRINSYGTFGASKTGAGGVAVAKDPKSRKFAAF
                     VEYLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILFFALWALNLIYLKFSFRLYRGLA
                     YAFWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSLSQEWLNAIGLVDFRAIGESGAL
                     FLQLLAPIALFVVTMLQLKFFHGPWSRATSPRRAENDPPTSTTEAAAVASTSGTQGRA
                     HAAGDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVILLS
                     LAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPELSQIDRGVGADNCSHGNISM
                     PEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKVFP
                     DFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVLFA
                     LNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFNLS
                     YLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREGEDNDSIYNDGNFVIKPENPQ
                     YDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNN
                     LYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCI
                     VRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSWYF
                     QHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQKQI
                     ERGAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLVEPVDSFVPEVDPKATAYDRLDP
                     GQIMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALIAVSEPEARKPGGTEETDGDEDE
                     DNKDSKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESL
                     SNTSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGA
                     HTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVI
                     KFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLR
                     KLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVI
                     PSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFL
                     IMTFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLI
                     YQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCI
                     GNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFN
                     IKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMP
                     EKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSIL
                     RSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEF
                     TRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPN
                     QGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIAT
                     SEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILV
                     VGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLF
                     RSPATLIEWTRMSKKKQE"
     STS             2687..3562
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             4585..5618
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgacggtcc cgccgctttt aaaatcgtgc gtcgtcaaat tgctgcttcc ggcagcactg
       61 cttgcagctg ccataatccg gccgagcttt ttatcaattg gctacgtcct acttgcactt
      121 gtcagcgccg ttctgccacc aattcgaaag tctttagcac ttcccaaact agttggaaca
      181 ttcgttatta tcacttttct cttctgccta gcagtcgcac taggagttgg ttcctaccag
      241 atctcagaac aagttgttca taaaaatgac cggacataca tttgcaatcg atccgacact
      301 actctgttcc ggagcattgg ccttgtccga ttccatccaa caggaacatt tgaatcaact
      361 cgagcatttc ttccggagat tattgccacg tctgcagctc tgctcactat cataatcgtc
      421 atgtttttgt cgcatagaga cgagcaattg gacgtcgttg gtgatgttgt aacagtcagg
      481 agtgaatctg gccgcgagca acgacgacaa agaaagttag ccgctataat gtggagtgca
      541 atcggaaatt ctctacgaag attgactaat ttcgtgcttt tcctgttcac ggcatatgtt
      601 ggaatcgtga aaccatcgct gagtaactca atttactttc tcgcttttct gttcatatcc
      661 acgtggtggt ccacatacac accactgaga catggagtgt acaatcagat aaagaagttt
      721 ctcatattct actcggcgct tcatttcttg gttctctaca catatcaaat tccgatcgtt
      781 caccactcat ggctgccgac cggttcattt ctgccacgtc tgttcggact tactgtactc
      841 atggattcat catgtcccga atggtggaag tttccatttg tagctccaga ctttaacgat
      901 gatgatttga ttatgaaatg gccgttgtat gcaaatccga ttgttgtact ggtgttcttc
      961 tacctcacag ttgctcaata caaattcacg agaaacggat ctcgtgaata tatcgatgat
     1021 aacgaatatg ggtcatcagt tcacgaagaa cgttttgtct ccgccggcac tgtcgaaacg
     1081 aatgtggacg acgtgggtca gctcatttca atttctgaga gcacagcttc tgctccatct
     1141 ggcagaggac gtggaaatac tttgcttctg tccaatgcat cctcctctgc taatgatgat
     1201 gaacagggtc gagctcgttc gcgatctccg ctgcgaaatg gtgaagaaca aggctcaatc
     1261 ccactacgga aagttacttc gcaagttgtt gataggaata agttgagcaa catttttaat
     1321 actacagcac ccggagataa ggaatctgct gcttcgaaag gaatgattgc agtcatgaca
     1381 tttgtcattt tccattcgta ttcaatcgcg ctgactgcta tgatgacatg ggctctcctc
     1441 tatcattcga tattcggtct cattctcctc atcctcacat gtatcttgtg gatcttccgt
     1501 gatacgagaa agtcatcgtt tgcaatggcc cctattattt tgatgtatat cgagtttcta
     1561 ttgattcttc aatatttcct cagtatggat attcatgcag aaattggcga tccagcgtgg
     1621 atgaactttg ttggaatcga atggactact cttccagtac atgctgtcat cattctctgt
     1681 gtccagactc ttctcactct cccagtgttc ttgcttctac gtttggctcg cagggagaag
     1741 ttttacgaat cgctgagtga ttatgaacga caacgacgaa tcaactcata tggaacattt
     1801 ggagcatcaa agactggagc tgggggtgtt gcagtggcta aggatccaaa aagtcggaag
     1861 ttcgcggcat ttgtggaata tctgtcgaat aaagtgtctg tctacttcat atttgtagta
     1921 tcagtggtac ttttggtggt ctctacgtgt tttgctccga atttctacaa tattctattc
     1981 ttcgcactat gggcattgaa cttgatttat ctcaagttct cattccgtct gtatcgtgga
     2041 ttggcatatg cattctggct aactctcacg ttctacactt caattgttat tatcgccctc
     2101 tacatttatc agttccctgg agtatctcaa tggattattc gaaatactag tttgtcgcag
     2161 gagtggctga atgcaattgg acttgtcgat tttagagcta tcggtgaatc gggagcccta
     2221 tttctacaat tactcgcccc aattgccttg ttcgtcgtca caatgctcca actcaagttt
     2281 ttccatggac catggagtcg agcaacgtca ccaagaagag cagaaaatga tccacctaca
     2341 agtacgacgg aggctgcggc ggtagcaagc acatctggaa cacaaggaag agcacatgct
     2401 gcaggcgata cccttgtcaa gaagctgcac aaattggcaa atcagacaat cgaactgtta
     2461 tggaggtttt tcgaagttca catttcgaaa attgtctttg tcatcattgc gatttttatt
     2521 gccaacaata tcaatgctct atacattcca cttgttattc tcctctcatt ggctatatgt
     2581 ctaccatcag ctgcagatgg gatattctct ttatttatgt gtgcctactt attcctcgtg
     2641 gcactgagca agatgatcta ccaactggat attgttcccg agttatcaca aatcgaccga
     2701 ggagttggag cagataactg ttcacatgga aatatttcaa tgcctgaatg gtttggattg
     2761 aagaaggaag ttgaaggaac tgaaccaatt tatatgctct ttggagtcat tgtttcgatt
     2821 attgcattgg cttttcaatc aattgttata tatcgacaaa gacattatcg agcttcactg
     2881 ggacttcctg aatcgatgcg agctaaagtg ttcccggact tccatcattc tcattttgat
     2941 agatctctca aaaatgccat ccaattcttg atagactatg gtttctataa gtttggactt
     3001 gaaatcacga tgatcgccat tggaattgac attttcaatc gaatggatgc attggcagcg
     3061 attcaatgtt tctggcttgt cctgtttgcg ctcaataaaa gagtctttgt tcgaagaata
     3121 tgggtattct atgtgatcta tatggcgatt ctgtatccac ttcagttctt ttcatatgtt
     3181 ggattaccac ctgacagttg tattgagtat ccatggtcgt attggattcc atcgtatagt
     3241 gatgatgcga gattcaatct gtcgtatctt ctgaacttgt caatatacgg tgtaaactgg
     3301 ccatcagcat atctcattgg cgatttcttc gtactcctct tggcatcatg ccaattagca
     3361 gttttccggc gagaaggaga agataatgat tcaatttaca atgatggaaa ctttgtgatt
     3421 aagccagaaa atccacaata tgactttatt gacaccaaaa agagttacgt tgattatttc
     3481 aaatcattcg ttttccatta tggacactgg attacattga tgtctacact agcagcagga
     3541 attgctggaa cgtcactttt tgctttggga tacattatat tcactctgac aatgctgtgg
     3601 tctggtaaca atttgtatgt gatgaactca actctacgat catttgaaca tactttgaaa
     3661 cgatggaatg cacttttggg atacacattg ttcacgatta caatgaaagt ttgccttcaa
     3721 atatttggat gtgtattcct gtcgtggttc gatcaatctg gtggatgggg aaagactctg
     3781 tgcatcgttc gtcaactctt cagtatcaca tgtgttaata acgaatgtca tgtgctcaaa
     3841 gagctggagg atttctcgaa ggcgtgtgct gttgagacga aagaaggaaa tattggattt
     3901 gatgtgattg cgctatcctt cctcgtcttc caaatccgaa ttttccattc ttggtatttc
     3961 caacactgca tggttgaata tcgaagtgag gttattctgg ccaatagagg tgccgtgctg
     4021 aagaatcaac tgattgaaaa ggaaatgaag gaacaaaacg agcagcaaaa agccaagttc
     4081 aatgatatca gaagaagaac tgaagctatt cgtgaaagat atcaaaaaca aatcgaacga
     4141 ggagctgctg aacgtgactt cgagccggtt acttatgggc acgccaaacg agcgggagac
     4201 tactacatgt tcaaatacga tcctgaaaat gatgatcttg tggaacccgt cgacagtttt
     4261 gtaccagaag ttgatcccaa ggcaactgca tatgatcgac ttgatcctgg acagataatg
     4321 tacgctgcca ccgctcacga cctcgacctc gccaaaactg tacagcaagt caagaaaggc
     4381 gatactatca aagatcctga ttcacgtgct cttatcgctg tttctgaacc agaagctcgt
     4441 aagccaggag gcactgaaga aacggatggt gatgaagatg aggataataa ggattcgaaa
     4501 gtggaaagta ctgctaaatt cattcaaaaa atgatcgctt ctgccttgga cttgtgtagt
     4561 gtaacactaa acaaactgtg cagagaacac cgatatgttg gatttgtttt gagcaaggaa
     4621 aaacaaaagt tgaagtcagg acactcggaa tctctttcaa atacatctag aaagctgacg
     4681 gatattcgat ctgcagttga tctaccaagt cttcaacttg tgcaatcggc gaatgatgtt
     4741 gaaaagatgg agacagccgt cagcgtggat tggcaacaaa aatcatcagc aacgagacta
     4801 ttgaatgcag ttgtgaattg tattggagca cacactgata ttctctgcta cttcttcgca
     4861 attatgacac aagtgatgac tggtggactt attactcttc cacttcctct gatgtcacta
     4921 ttctggggaa atctatcgaa tcctcgtcca tccaagttct tctgggtcac aatgatcacc
     4981 tacactgagt gtgtcattgt tatcaagttt gtttgccaat ttgcattcat gccttacaat
     5041 tctatcacgt ggcgaacaga gcatcaaatg gacccgatgt cattggataa gttattcgga
     5101 gtatcacaga gagatagttt tgcactttgg gacattgttt tgctcttctc actcttcttc
     5161 catcggtata tgctcagaaa gttagggtta tggaaggatg ccaatttgac ggacacgttc
     5221 actttgaagg aagagcctcg atcggcgtca ggatcggaca caggatcacc caagaaaatt
     5281 gctcaagagc caaaggttgt tgtaactcag tcagataccc ttgaaggtac aagtggagga
     5341 gagatagtca taccatctga tccaaatgca gtttccaata tggaagaatt agactgcgaa
     5401 cctccgattc cagagaagca aagtggacca attggaagat tcattcatca attattccat
     5461 ccaaaattcc gttacattcg tgatttgtat ccaataatgt ttggaatcga tgtgatatgc
     5521 ttcctcatca tgacatttgg atactcggca tttggtgaag gaggttctgg aaatgtttta
     5581 gatgatgtga aggcttctcg tattccggta acacttgttg ttatgctcgt tggaatgact
     5641 ctggcaatta tcattgatcg agcactctac ctcagaaaat cagttgtcgg aaagctaatc
     5701 tatcaagtct taatgattgc tttccttcac atttgggtat tccttgttct tccaaatatg
     5761 actcgtcgtt ctgcgatatc gaatcacgtt gctcaagcat tgtacgtcat caaatcgtgc
     5821 tatttccttg tgtctgcttg gcagatccga aatggttatc ctgaactttg tattggaaat
     5881 ctattaacac attcatacgg aatgaccaat atgattgcat tcaaagtatt catgaatatt
     5941 ccattcctct tcgagcttcg tacagctatt gattggacat ggacagatac ttcaatgcct
     6001 cttttcgatt tcttcaatat ggaaaatttc tatgctcata tattcaatat caagtgtgcc
     6061 cgccagttcg aagctgccta tccagctcca agagggattc ccaaaggaaa gttggtcaag
     6121 tatatgatgg gattcccaat tatcattgga gtcgttatct tcatcttttc tcctctattg
     6181 ctctggtcgc tactcaatca aatcggaact atcagtatgc cagaaaaagt tacgttgagg
     6241 atttcgattg aaggatatcc accactttac gagatggagg cacaaggaag taatcacgat
     6301 aacgctgaac ttggaatgat aaaacctgat caattggcat ctttgaatca agcattgacg
     6361 gatagttaca cgacacgaga cactaattct attttaagat caagaatgtc tgtatcatat
     6421 ctgaaaggat acacatatga ggatattctg attgtgcgat tccgtccaga atctgaaatt
     6481 tattggccga tttcacagga ttcgagaaat gcgatgatcg ataaattgag ccgaaacacg
     6541 tcagtcaatt ttgaagtatc tctggaattc actcggccat atgatccaaa tgaaaacgct
     6601 gctttaaaac attcgaaatc gtggcttgtt ccaatctccc tggatatgac gattcgagca
     6661 aaaattcaaa gtgctctccg aggagatcca ggtcatccga ttctcattcc acagtcaatt
     6721 cctgcgttta ttcaagttcc aaatcaagga gaattgaccc ttccaacatc aatcggaaat
     6781 actattatca atgacggaaa tccacggatt aatacgaccg ggatggaaaa atcagacgaa
     6841 gctcgggctt ggttcgactc gttaaccttg aatctcgaac aaggaaaatc gcaaaacgag
     6901 aaaatgtgga tcgccacatc cgaacatcca ggagaccaaa atgcgaaact ctggataaag
     6961 actgcaaata cgacgtattc gggaaggccg taccttcaag ttgtcggatt tattgataga
     7021 gcattcccat catttttggc gaaagttttc aaaggaggag tcattgcagt gtatctttca
     7081 gttatcctcg tcgttggaag aggtctggtt cgtggaatct tcaccacatc tccaagcact
     7141 gtcatgttca cagaattacc gaatgcggat catcttctca aaatttgtct cgacatctat
     7201 ttggttcgag aagcgaagga cttcatgttg gagcaggatc tcttcgccaa attaatattc
     7261 ctgttccgat caccagcgac actcatcgaa tggacacgaa tgagcaaaaa gaagcaagaa
     7321 taa
//