Dbfetch

LOCUS       NM_001268457            5193 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001268457
VERSION     NM_001268457.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5193)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5193)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5193)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5193)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Apr 20, 2015 this sequence version replaced NM_001268457.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5193
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>5193
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..5193
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1j"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001255386.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1j"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:B9WRT3"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="UniProtKB/TrEMBL:B9WRT3"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MLTKSIVSSSGDSGIYEDGCGIMPYIDDDDDLTPIIMARPAIGS
                     GYTGGRNGWHRSPRQYLTNWWSDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAI
                     FIANNINALYIPLVILLSLAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPELS
                     QIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQR
                     HYRASLGLPESMRAKVFPDFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGIDIF
                     NRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEY
                     PWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREGED
                     NDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSL
                     FALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGC
                     VFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDV
                     IALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKF
                     NDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHECMRIDEDDPFPYYDLRISSQDTE
                     NEAKRAGDYYMFKYDPENDDLVEPVDSFVPEVDPKATAYDRLDPGQIMYAATAHDLDL
                     AKTVQQVKKGDTIKDPDSRALIAVSEPEARKPGGTEETDGDEDEDNKDSKVESTAKFI
                     QKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAV
                     DLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQ
                     VMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSI
                     TWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTF
                     TLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELD
                     CEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEGGS
                     GNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVF
                     LVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMI
                     AFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAP
                     RGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPP
                     LYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTY
                     EDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEFTRPYDPNENAALKH
                     SKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTI
                     INDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIK
                     TANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSP
                     STVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSK
                     KKQE"
     STS             479..1354
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             2455..3488
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgctaacaa agtcaatagt gagtagtagt ggtgactctg gtatttacga agacggttgt
       61 ggtatcatgc cgtacattga cgacgacgat gatttgacgc caattataat ggcaagacct
      121 gctattggca gtgggtacac gggtggcagg aacggatggc atagatcacc caggcagtat
      181 ttgaccaact ggtggagcga tacccttgtc aagaagctgc acaaattggc aaatcagaca
      241 atcgaactgt tatggaggtt tttcgaagtt cacatttcga aaattgtctt tgtcatcatt
      301 gcgattttta ttgccaacaa tatcaatgct ctatacattc cacttgttat tctcctctca
      361 ttggctatat gtctaccatc agctgcagat gggatattct ctttatttat gtgtgcctac
      421 ttattcctcg tggcactgag caagatgatc taccaactgg atattgttcc cgagttatca
      481 caaatcgacc gaggagttgg agcagataac tgttcacatg gaaatatttc aatgcctgaa
      541 tggtttggat tgaagaagga agttgaagga actgaaccaa tttatatgct ctttggagtc
      601 attgtttcga ttattgcatt ggcttttcaa tcaattgtta tatatcgaca aagacattat
      661 cgagcttcac tgggacttcc tgaatcgatg cgagctaaag tgttcccgga cttccatcat
      721 tctcattttg atagatctct caaaaatgcc atccaattct tgatagacta tggtttctat
      781 aagtttggac ttgaaatcac gatgatcgcc attggaattg acattttcaa tcgaatggat
      841 gcattggcag cgattcaatg tttctggctt gtcctgtttg cgctcaataa aagagtcttt
      901 gttcgaagaa tatgggtatt ctatgtgatc tatatggcga ttctgtatcc acttcagttc
      961 ttttcatatg ttggattacc acctgacagt tgtattgagt atccatggtc gtattggatt
     1021 ccatcgtata gtgatgatgc gagattcaat ctgtcgtatc ttctgaactt gtcaatatac
     1081 ggtgtaaact ggccatcagc atatctcatt ggcgatttct tcgtactcct cttggcatca
     1141 tgccaattag cagttttccg gcgagaagga gaagataatg attcaattta caatgatgga
     1201 aactttgtga ttaagccaga aaatccacaa tatgacttta ttgacaccaa aaagagttac
     1261 gttgattatt tcaaatcatt cgttttccat tatggacact ggattacatt gatgtctaca
     1321 ctagcagcag gaattgctgg aacgtcactt tttgctttgg gatacattat attcactctg
     1381 acaatgctgt ggtctggtaa caatttgtat gtgatgaact caactctacg atcatttgaa
     1441 catactttga aacgatggaa tgcacttttg ggatacacat tgttcacgat tacaatgaaa
     1501 gtttgccttc aaatatttgg atgtgtattc ctgtcgtggt tcgatcaatc tggtggatgg
     1561 ggaaagactc tgtgcatcgt tcgtcaactc ttcagtatca catgtgttaa taacgaatgt
     1621 catgtgctca aagagctgga ggatttctcg aaggcgtgtg ctgttgagac gaaagaagga
     1681 aatattggat ttgatgtgat tgcgctatcc ttcctcgtct tccaaatccg aattttccat
     1741 tcttggtatt tccaacactg catggttgaa tatcgaagtg aggttattct ggccaataga
     1801 ggtgccgtgc tgaagaatca actgattgaa aaggaaatga aggaacaaaa cgagcagcaa
     1861 aaagccaagt tcaatgatat cagaagaaga actgaagcta ttcgtgaaag atatcaaaaa
     1921 caaatcgaac gaggagctgc tgaacgtgac ttcgagccgg ttacttatgg gcacgaatgt
     1981 atgcgtatcg acgaggatga cccatttcct tactatgact tgcgtatatc atcgcaagat
     2041 actgaaaatg aggccaaacg agcgggagac tactacatgt tcaaatacga tcctgaaaat
     2101 gatgatcttg tggaacccgt cgacagtttt gtaccagaag ttgatcccaa ggcaactgca
     2161 tatgatcgac ttgatcctgg acagataatg tacgctgcca ccgctcacga cctcgacctc
     2221 gccaaaactg tacagcaagt caagaaaggc gatactatca aagatcctga ttcacgtgct
     2281 cttatcgctg tttctgaacc agaagctcgt aagccaggag gcactgaaga aacggatggt
     2341 gatgaagatg aggataataa ggattcgaaa gtggaaagta ctgctaaatt cattcaaaaa
     2401 atgatcgctt ctgccttgga cttgtgtagt gtaacactaa acaaactgtg cagagaacac
     2461 cgatatgttg gatttgtttt gagcaaggaa aaacaaaagt tgaagtcagg acactcggaa
     2521 tctctttcaa atacatctag aaagctgacg gatattcgat ctgcagttga tctaccaagt
     2581 cttcaacttg tgcaatcggc gaatgatgtt gaaaagatgg agacagccgt cagcgtggat
     2641 tggcaacaaa aatcatcagc aacgagacta ttgaatgcag ttgtgaattg tattggagca
     2701 cacactgata ttctctgcta cttcttcgca attatgacac aagtgatgac tggtggactt
     2761 attactcttc cacttcctct gatgtcacta ttctggggaa atctatcgaa tcctcgtcca
     2821 tccaagttct tctgggtcac aatgatcacc tacactgagt gtgtcattgt tatcaagttt
     2881 gtttgccaat ttgcattcat gccttacaat tctatcacgt ggcgaacaga gcatcaaatg
     2941 gacccgatgt cattggataa gttattcgga gtatcacaga gagatagttt tgcactttgg
     3001 gacattgttt tgctcttctc actcttcttc catcggtata tgctcagaaa gttagggtta
     3061 tggaaggatg ccaatttgac ggacacgttc actttgaagg aagagcctcg atcggcgtca
     3121 ggatcggaca caggatcacc caagaaaatt gctcaagagc caaaggttgt tgtaactcag
     3181 tcagataccc ttgaaggtac aagtggagga gagatagtca taccatctga tccaaatgca
     3241 gtttccaata tggaagaatt agactgcgaa cctccgattc cagagaagca aagtggacca
     3301 attggaagat tcattcatca attattccat ccaaaattcc gttacattcg tgatttgtat
     3361 ccaataatgt ttggaatcga tgtgatatgc ttcctcatca tgacatttgg atactcggca
     3421 tttggtgaag gaggttctgg aaatgtttta gatgatgtga aggcttctcg tattccggta
     3481 acacttgttg ttatgctcgt tggaatgact ctggcaatta tcattgatcg agcactctac
     3541 ctcagaaaat cagttgtcgg aaagctaatc tatcaagtct taatgattgc tttccttcac
     3601 atttgggtat tccttgttct tccaaatatg actcgtcgtt ctgcgatatc gaatcacgtt
     3661 gctcaagcat tgtacgtcat caaatcgtgc tatttccttg tgtctgcttg gcagatccga
     3721 aatggttatc ctgaactttg tattggaaat ctattaacac attcatacgg aatgaccaat
     3781 atgattgcat tcaaagtatt catgaatatt ccattcctct tcgagcttcg tacagctatt
     3841 gattggacat ggacagatac ttcaatgcct cttttcgatt tcttcaatat ggaaaatttc
     3901 tatgctcata tattcaatat caagtgtgcc cgccagttcg aagctgccta tccagctcca
     3961 agagggattc ccaaaggaaa gttggtcaag tatatgatgg gattcccaat tatcattgga
     4021 gtcgttatct tcatcttttc tcctctattg ctctggtcgc tactcaatca aatcggaact
     4081 atcagtatgc cagaaaaagt tacgttgagg atttcgattg aaggatatcc accactttac
     4141 gagatggagg cacaaggaag taatcacgat aacgctgaac ttggaatgat aaaacctgat
     4201 caattggcat ctttgaatca agcattgacg gatagttaca cgacacgaga cactaattct
     4261 attttaagat caagaatgtc tgtatcatat ctgaaaggat acacatatga ggatattctg
     4321 attgtgcgat tccgtccaga atctgaaatt tattggccga tttcacagga ttcgagaaat
     4381 gcgatgatcg ataaattgag ccgaaacacg tcagtcaatt ttgaagtatc tctggaattc
     4441 actcggccat atgatccaaa tgaaaacgct gctttaaaac attcgaaatc gtggcttgtt
     4501 ccaatctccc tggatatgac gattcgagca aaaattcaaa gtgctctccg aggagatcca
     4561 ggtcatccga ttctcattcc acagtcaatt cctgcgttta ttcaagttcc aaatcaagga
     4621 gaattgaccc ttccaacatc aatcggaaat actattatca atgacggaaa tccacggatt
     4681 aatacgaccg ggatggaaaa atcagacgaa gctcgggctt ggttcgactc gttaaccttg
     4741 aatctcgaac aaggaaaatc gcaaaacgag aaaatgtgga tcgccacatc cgaacatcca
     4801 ggagaccaaa atgcgaaact ctggataaag actgcaaata cgacgtattc gggaaggccg
     4861 taccttcaag ttgtcggatt tattgataga gcattcccat catttttggc gaaagttttc
     4921 aaaggaggag tcattgcagt gtatctttca gttatcctcg tcgttggaag aggtctggtt
     4981 cgtggaatct tcaccacatc tccaagcact gtcatgttca cagaattacc gaatgcggat
     5041 catcttctca aaatttgtct cgacatctat ttggttcgag aagcgaagga cttcatgttg
     5101 gagcaggatc tcttcgccaa attaatattc ctgttccgat caccagcgac actcatcgaa
     5161 tggacacgaa tgagcaaaaa gaagcaagaa taa
//