Dbfetch

LOCUS       NM_001268456            5115 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Piezo-type mechanosensitive ion channel
            component (pezo-1), partial mRNA.
ACCESSION   NM_001268456
VERSION     NM_001268456.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5115)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5115)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5115)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5115)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Apr 20, 2015 this sequence version replaced NM_001268456.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5115
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>5115
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /db_xref="GeneID:182492"
                     /db_xref="WormBase:WBGene00007505"
     CDS             1..5115
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="C10C5.1i"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Piezo-type mechanosensitive ion channel
                     component"
                     /protein_id="NP_001255385.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007505"
                     /db_xref="EnsemblGenomes-Tr:C10C5.1i"
                     /db_xref="GeneID:182492"
                     /db_xref="GOA:O01260"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="InterPro:IPR031334"
                     /db_xref="InterPro:IPR031805"
                     /db_xref="PDB:4PKE"
                     /db_xref="PDB:4PKX"
                     /db_xref="UniProtKB/TrEMBL:O01260"
                     /db_xref="WormBase:WBGene00007505"
                     /translation="MLTKSIVSSSGDSGIYEDGCGIMPYIDDDDDLTPIIMARPAIGS
                     GYTGGRNGWHRSPRQYLTNWWSDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAI
                     FIANNINALYIPLVILLSLAICLPSAADGIFSLFMCAYLFLVALSKMIYQLDIVPELS
                     QIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQR
                     HYRASLGLPESMRAKVFPDFHHSHFDRSLKNAIQFLIDYGFYKFGLEITMIAIGIDIF
                     NRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEY
                     PWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVFRREGED
                     NDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSL
                     FALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGC
                     VFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDV
                     IALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKF
                     NDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFKYDPENDDLVEPVD
                     SFVPEVDPKATAYDRLDPGQIMYAATAHDLDLAKTVQQVKKGDTIKDPDSRALIAVSE
                     PEARKPGGTEETDGDEDEDNKDSKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVG
                     FVLSKEKQKLKSGHSESLSNTSRKLTDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQ
                     QKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRP
                     SKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFA
                     LWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKV
                     VVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFR
                     YIRDLYPIMFGIDVICFLIMTFGYSAFGEGGSGNVLDDVKASRIPVTLVVMLVGMTLA
                     IIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSC
                     YFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTS
                     MPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIF
                     SPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLAS
                     LNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAM
                     IDKLSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDP
                     GHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSL
                     TLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFL
                     AKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVRE
                     AKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE"
     STS             479..1354
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.11"
                     /db_xref="UniSTS:310904"
     STS             2377..3410
                     /gene="pezo-1"
                     /locus_tag="CELE_C10C5.1"
                     /standard_name="T20D3.9"
                     /db_xref="UniSTS:306090"
ORIGIN      
        1 atgctaacaa agtcaatagt gagtagtagt ggtgactctg gtatttacga agacggttgt
       61 ggtatcatgc cgtacattga cgacgacgat gatttgacgc caattataat ggcaagacct
      121 gctattggca gtgggtacac gggtggcagg aacggatggc atagatcacc caggcagtat
      181 ttgaccaact ggtggagcga tacccttgtc aagaagctgc acaaattggc aaatcagaca
      241 atcgaactgt tatggaggtt tttcgaagtt cacatttcga aaattgtctt tgtcatcatt
      301 gcgattttta ttgccaacaa tatcaatgct ctatacattc cacttgttat tctcctctca
      361 ttggctatat gtctaccatc agctgcagat gggatattct ctttatttat gtgtgcctac
      421 ttattcctcg tggcactgag caagatgatc taccaactgg atattgttcc cgagttatca
      481 caaatcgacc gaggagttgg agcagataac tgttcacatg gaaatatttc aatgcctgaa
      541 tggtttggat tgaagaagga agttgaagga actgaaccaa tttatatgct ctttggagtc
      601 attgtttcga ttattgcatt ggcttttcaa tcaattgtta tatatcgaca aagacattat
      661 cgagcttcac tgggacttcc tgaatcgatg cgagctaaag tgttcccgga cttccatcat
      721 tctcattttg atagatctct caaaaatgcc atccaattct tgatagacta tggtttctat
      781 aagtttggac ttgaaatcac gatgatcgcc attggaattg acattttcaa tcgaatggat
      841 gcattggcag cgattcaatg tttctggctt gtcctgtttg cgctcaataa aagagtcttt
      901 gttcgaagaa tatgggtatt ctatgtgatc tatatggcga ttctgtatcc acttcagttc
      961 ttttcatatg ttggattacc acctgacagt tgtattgagt atccatggtc gtattggatt
     1021 ccatcgtata gtgatgatgc gagattcaat ctgtcgtatc ttctgaactt gtcaatatac
     1081 ggtgtaaact ggccatcagc atatctcatt ggcgatttct tcgtactcct cttggcatca
     1141 tgccaattag cagttttccg gcgagaagga gaagataatg attcaattta caatgatgga
     1201 aactttgtga ttaagccaga aaatccacaa tatgacttta ttgacaccaa aaagagttac
     1261 gttgattatt tcaaatcatt cgttttccat tatggacact ggattacatt gatgtctaca
     1321 ctagcagcag gaattgctgg aacgtcactt tttgctttgg gatacattat attcactctg
     1381 acaatgctgt ggtctggtaa caatttgtat gtgatgaact caactctacg atcatttgaa
     1441 catactttga aacgatggaa tgcacttttg ggatacacat tgttcacgat tacaatgaaa
     1501 gtttgccttc aaatatttgg atgtgtattc ctgtcgtggt tcgatcaatc tggtggatgg
     1561 ggaaagactc tgtgcatcgt tcgtcaactc ttcagtatca catgtgttaa taacgaatgt
     1621 catgtgctca aagagctgga ggatttctcg aaggcgtgtg ctgttgagac gaaagaagga
     1681 aatattggat ttgatgtgat tgcgctatcc ttcctcgtct tccaaatccg aattttccat
     1741 tcttggtatt tccaacactg catggttgaa tatcgaagtg aggttattct ggccaataga
     1801 ggtgccgtgc tgaagaatca actgattgaa aaggaaatga aggaacaaaa cgagcagcaa
     1861 aaagccaagt tcaatgatat cagaagaaga actgaagcta ttcgtgaaag atatcaaaaa
     1921 caaatcgaac gaggagctgc tgaacgtgac ttcgagccgg ttacttatgg gcacgccaaa
     1981 cgagcgggag actactacat gttcaaatac gatcctgaaa atgatgatct tgtggaaccc
     2041 gtcgacagtt ttgtaccaga agttgatccc aaggcaactg catatgatcg acttgatcct
     2101 ggacagataa tgtacgctgc caccgctcac gacctcgacc tcgccaaaac tgtacagcaa
     2161 gtcaagaaag gcgatactat caaagatcct gattcacgtg ctcttatcgc tgtttctgaa
     2221 ccagaagctc gtaagccagg aggcactgaa gaaacggatg gtgatgaaga tgaggataat
     2281 aaggattcga aagtggaaag tactgctaaa ttcattcaaa aaatgatcgc ttctgccttg
     2341 gacttgtgta gtgtaacact aaacaaactg tgcagagaac accgatatgt tggatttgtt
     2401 ttgagcaagg aaaaacaaaa gttgaagtca ggacactcgg aatctctttc aaatacatct
     2461 agaaagctga cggatattcg atctgcagtt gatctaccaa gtcttcaact tgtgcaatcg
     2521 gcgaatgatg ttgaaaagat ggagacagcc gtcagcgtgg attggcaaca aaaatcatca
     2581 gcaacgagac tattgaatgc agttgtgaat tgtattggag cacacactga tattctctgc
     2641 tacttcttcg caattatgac acaagtgatg actggtggac ttattactct tccacttcct
     2701 ctgatgtcac tattctgggg aaatctatcg aatcctcgtc catccaagtt cttctgggtc
     2761 acaatgatca cctacactga gtgtgtcatt gttatcaagt ttgtttgcca atttgcattc
     2821 atgccttaca attctatcac gtggcgaaca gagcatcaaa tggacccgat gtcattggat
     2881 aagttattcg gagtatcaca gagagatagt tttgcacttt gggacattgt tttgctcttc
     2941 tcactcttct tccatcggta tatgctcaga aagttagggt tatggaagga tgccaatttg
     3001 acggacacgt tcactttgaa ggaagagcct cgatcggcgt caggatcgga cacaggatca
     3061 cccaagaaaa ttgctcaaga gccaaaggtt gttgtaactc agtcagatac ccttgaaggt
     3121 acaagtggag gagagatagt cataccatct gatccaaatg cagtttccaa tatggaagaa
     3181 ttagactgcg aacctccgat tccagagaag caaagtggac caattggaag attcattcat
     3241 caattattcc atccaaaatt ccgttacatt cgtgatttgt atccaataat gtttggaatc
     3301 gatgtgatat gcttcctcat catgacattt ggatactcgg catttggtga aggaggttct
     3361 ggaaatgttt tagatgatgt gaaggcttct cgtattccgg taacacttgt tgttatgctc
     3421 gttggaatga ctctggcaat tatcattgat cgagcactct acctcagaaa atcagttgtc
     3481 ggaaagctaa tctatcaagt cttaatgatt gctttccttc acatttgggt attccttgtt
     3541 cttccaaata tgactcgtcg ttctgcgata tcgaatcacg ttgctcaagc attgtacgtc
     3601 atcaaatcgt gctatttcct tgtgtctgct tggcagatcc gaaatggtta tcctgaactt
     3661 tgtattggaa atctattaac acattcatac ggaatgacca atatgattgc attcaaagta
     3721 ttcatgaata ttccattcct cttcgagctt cgtacagcta ttgattggac atggacagat
     3781 acttcaatgc ctcttttcga tttcttcaat atggaaaatt tctatgctca tatattcaat
     3841 atcaagtgtg cccgccagtt cgaagctgcc tatccagctc caagagggat tcccaaagga
     3901 aagttggtca agtatatgat gggattccca attatcattg gagtcgttat cttcatcttt
     3961 tctcctctat tgctctggtc gctactcaat caaatcggaa ctatcagtat gccagaaaaa
     4021 gttacgttga ggatttcgat tgaaggatat ccaccacttt acgagatgga ggcacaagga
     4081 agtaatcacg ataacgctga acttggaatg ataaaacctg atcaattggc atctttgaat
     4141 caagcattga cggatagtta cacgacacga gacactaatt ctattttaag atcaagaatg
     4201 tctgtatcat atctgaaagg atacacatat gaggatattc tgattgtgcg attccgtcca
     4261 gaatctgaaa tttattggcc gatttcacag gattcgagaa atgcgatgat cgataaattg
     4321 agccgaaaca cgtcagtcaa ttttgaagta tctctggaat tcactcggcc atatgatcca
     4381 aatgaaaacg ctgctttaaa acattcgaaa tcgtggcttg ttccaatctc cctggatatg
     4441 acgattcgag caaaaattca aagtgctctc cgaggagatc caggtcatcc gattctcatt
     4501 ccacagtcaa ttcctgcgtt tattcaagtt ccaaatcaag gagaattgac ccttccaaca
     4561 tcaatcggaa atactattat caatgacgga aatccacgga ttaatacgac cgggatggaa
     4621 aaatcagacg aagctcgggc ttggttcgac tcgttaacct tgaatctcga acaaggaaaa
     4681 tcgcaaaacg agaaaatgtg gatcgccaca tccgaacatc caggagacca aaatgcgaaa
     4741 ctctggataa agactgcaaa tacgacgtat tcgggaaggc cgtaccttca agttgtcgga
     4801 tttattgata gagcattccc atcatttttg gcgaaagttt tcaaaggagg agtcattgca
     4861 gtgtatcttt cagttatcct cgtcgttgga agaggtctgg ttcgtggaat cttcaccaca
     4921 tctccaagca ctgtcatgtt cacagaatta ccgaatgcgg atcatcttct caaaatttgt
     4981 ctcgacatct atttggttcg agaagcgaag gacttcatgt tggagcagga tctcttcgcc
     5041 aaattaatat tcctgttccg atcaccagcg acactcatcg aatggacacg aatgagcaaa
     5101 aagaagcaag aataa
//