Dbfetch

LOCUS       NM_001268448            5358 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase WNK (wnk-1),
            partial mRNA.
ACCESSION   NM_001268448
VERSION     NM_001268448.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5358)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5358)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5358)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5358)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5358
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>5358
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /db_xref="GeneID:177743"
                     /db_xref="WormBase:WBGene00006941"
     CDS             1..5358
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /standard_name="C46C2.1c"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase WNK"
                     /protein_id="NP_001255377.1"
                     /db_xref="GeneID:177743"
                     /db_xref="GOA:X5M5N0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024678"
                     /db_xref="UniProtKB/Swiss-Prot:X5M5N0"
                     /db_xref="WormBase:WBGene00006941"
                     /translation="MGSHWLSEQERSRLEAVQQDWRRTRPMKWTSKKRPDDPTTSSPS
                     TVSISNALENSTPSLNNVSSITNSSSPFSLSSAATSTASAIIPFTSNVATNHPHLNHH
                     VSRIPQAIVTGGTNGSLPPLLISPTSAAAATPLISGKAGPMSPSTGSPINVAATVLQN
                     AVSSPQHSIFDRSRLNKIPPNTSLASSSSPSDAANNDKPIQQRHSILSNVRTLTQAMV
                     NDGPRTLTGDDMDKMVSEEERARKEQEKREEEEKAARRIDVEDDFDAQEKPIDKSKNG
                     RFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQRFREEAEMLKDLQ
                     HPNIVRFYDYWESADLCGKRKYIVLVTELMTSGTLKMYLKRFKRINIKVLKSWCRQIL
                     KGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTPEFM
                     APEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIP
                     AQYPEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLNDLNVE
                     IQMQLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDEDTRMITK
                     LIKDKVDAFRRDRDHRLLEIKRAKEEEERIREEAEIKEELRLRAEAKEKEKERLEKER
                     LEKKAAAAAAANPNPTPIPPTPATPHSSAQQQPIPPPLSTQTSAEIQQSAQQPSVPVT
                     MIANIPAMSPTSAQPQPVLSPTSAAVPVPTTMIHVPKPSEIPVQNVATTAAPVAANNV
                     PPSPAPFKTEDIQTPTLAQNTVPRTISTDASGLVINTPASIASPSPAPSATDVASTTA
                     PVTPAPTPTTTTDGGAAAASTTTENKEEKRKSNKRKVVMEILGCDESRNFALVSCRLD
                     TSHKSVTFQFAPGTDKPCTIATKLLAEDCLLKVHVHIVEAQLGEVIQLINSDGKKGVG
                     TKLATVLDPNSTEPPTITAVMPKDSSAATASNTKPKIEIEKTPPTRDASQEPNNVQVT
                     NVRKVSQESNAESVQSIPRPGGIIVMSPTNQTDSAPPPTGAAAKPSRFQVTKSADPIA
                     TPISSSISTATVIPIVAATPTNITSEPVIVQPITAQVITHLATPSPVSHSLSSNSSPS
                     ATTHSNMSSIQSTTSVPGRRFTVQPVSQAESGISSSISTPHPEPTPAITSCPPPVPSV
                     PPVVSNGTLNLEVAPKQTPSATNQNVDTQHSSSTASTATLVSETPATVHVTPISVPAP
                     VQEPLVIDHHSDVLTQLDSELRKVSGVSHSASPSTVVESLTSMTPQTIPLACQTVPAS
                     IGQAPAVIAAAHAASLIPNASVPQSPSRLDAETGLAGLHEKLEALKMEQDRREDMGDD
                     AIGTTTTDGKDEIPIDTLKGLAEALGKVIHADGRETTPMPPDHPDLTDASTQQLISPS
                     NPDVLTTMSSAVEGSASSTMIEDIDASTSAVDASMMNSMPPGAQNSTDQIPAAMTLSM
                     DQECAQSMTSSITRNTTGTKLATFENLETALSSTLGTHIRQPNAPSSRDETTAPMTPS
                     FTNERIGGGGGGGATSFSIGTPPSHSPFPVSECDYDLKGQMDLESEDPEVIQMIVRHR
                     MEQHKLLEKQRVEIERLRSKIRVPRATSVNPEMIGDDEADTTLTALQSALGNASLSLP
                     ASPPPNTETTKVNTTVIPSDVLATRMTMSQSSTKSSNVSVSSRHRDNQSAPPRHHHHQ
                     PHPPHHPHLQNHYHPPQNHTSATAPCPSAMVQLQAVSNNNVNPLHQPPHPVSSQIPPQ
                     A"
ORIGIN      
        1 atgggatcac actggttgtc cgagcaagaa agatcacgac ttgaagctgt tcaacaggat
       61 tggcgaagaa ctcgaccaat gaaatggact tcaaaaaaga gaccagatga tccaacgaca
      121 tcatctccat cgacagtttc aattagtaat gcattggaaa attcaacacc ttcattaaac
      181 aatgtttctt cgatcacaaa ctcttcatca ccattttctt tatcgtcagc tgcaacatcg
      241 acagcttctg ccataatccc atttacctca aatgtagcta caaatcatcc acatcttaat
      301 caccacgtgt cgagaatacc acaggcgatt gtaacaggag ggacaaatgg ttcattacct
      361 ccattattaa tatcaccgac gtcagcagca gccgcaacgc cgttgatttc aggaaaagcg
      421 ggtccaatgt caccatcaac gggaagtcca attaatgtgg ctgctacagt attacagaat
      481 gcagtttcaa gtccacaaca tagtattttt gatagatcta ggttaaataa aattccacca
      541 aacacatcat tagcatcgtc ttcgtctccg agtgatgctg ctaacaatga taaacctata
      601 caacaacgtc atagtatttt atcgaatgtt cgaactctca ctcaagcaat ggtaaacgat
      661 ggaccacgaa cgttgactgg agatgatatg gacaagatgg tcagtgaaga ggaaagagca
      721 cgaaaagagc aagagaagcg agaagaagaa gagaaagcag cacggagaat tgatgttgaa
      781 gatgattttg atgcgcaaga aaaacccatt gataagagta aaaatggtcg attcttaaag
      841 ttcgacgaag aacttggtcg cggatcgttc aagacagtgt ttcgagggtt ggacactgaa
      901 accggagtgg ccgttgcgtg gtgtgagctt caggagagta aactgaataa gactgaaagg
      961 caacgttttc gagaagaagc tgaaatgctc aaggatctgc aacatccgaa catcgtacga
     1021 ttctacgatt attgggagag tgcggatttg tgtggaaaac ggaaatatat tgtgcttgta
     1081 accgaattga tgacttcagg aacattaaaa atgtatttga agcgatttaa acggataaac
     1141 ataaaggtat tgaaatcttg gtgcagacaa attctgaaag ggctttcatt tcttcacaca
     1201 cgtaatccac ctgtaattca tcgtgatctc aagtgtgata atatctttat cactggtaca
     1261 actggtagtg taaagattgg agatcttgga ttggcaactc ttaaaaataa atcattcgcg
     1321 aaatctgtca ttggaactcc agaattcatg gcaccggaaa tgtacgaaga gatgtatgat
     1381 gagagtgtag atgtctacgc gtttggaatg tgtcttcttg aaatggttac cggagaatat
     1441 ccatattctg agtgtatgaa tccagcgaca atctacagaa aagtgatatc aggtgtcaaa
     1501 ccagaatgtt tctcaagaat tcctgcacaa tatcctgaaa tacgtgagat aatcgatcgg
     1561 tgtattcgtg tgagacgaga agagagaagt accgtgaagc aattgctcgt tgacgatttc
     1621 ttcactccag aagatctcat cggaattcgt gttgaaatta agaatcggga tgctgatctc
     1681 aatgatctta acgtggaaat tcaaatgcaa ctccgagttt acgatgagaa aaagagaaaa
     1741 caatatcggt tcaaggagaa cgaaggactt caatttgcat ttgatattga aaatgacagc
     1801 ccagatgaag ttgttcaaca gatgatcgag caacaacata ttccagatga ggatactcga
     1861 atgataacaa agttgataaa agacaaagtg gatgcgttca gaagagatcg agatcatcgt
     1921 ttattggaga ttaaaagagc aaaagaggag gaagaaagga tacgagaaga ggctgagatt
     1981 aaagaggaat tgaggttgag agctgaagct aaagaaaagg aaaaggagag gttggagaaa
     2041 gaacgattag aaaaaaaagc tgcagctgcg gccgcagcca atccgaatcc tacaccaatt
     2101 ccaccaactc cagcaacacc acactcttct gcccaacaac agcctattcc accaccacta
     2161 tcaactcaaa cttcggctga aatacagcag tctgctcaac agccatctgt acctgtaact
     2221 atgatcgcaa atatcccagc tatgtcgcca acatcagctc aaccacaacc tgttttatca
     2281 ccaacaagtg cagcggttcc agttccaacg acaatgattc atgttccaaa acctagcgag
     2341 attccagtgc agaatgtagc gacgactgca gccccggttg cggctaacaa tgtaccacca
     2401 tcaccagctc cattcaaaac agaagatatc caaactccca cacttgccca gaatacggtt
     2461 ccacgaacaa tctccactga tgcttctgga cttgtcatca atactcctgc atcaatagca
     2521 tcaccatcac ctgctccttc ggctactgat gttgcttcaa caacggctcc agtcacccct
     2581 gctccaactc caacaacaac aacggacggt ggtgcagcag cagcttcaac aacaactgaa
     2641 aacaaggaag aaaagcgaaa aagcaacaaa agaaaagtgg taatggagat tttgggatgt
     2701 gatgaatcga ggaattttgc attggtctcg tgtcgacttg acacttctca taaatctgtt
     2761 accttccaat ttgcaccagg aactgacaaa ccatgcacaa ttgcaacgaa acttttggct
     2821 gaagattgtc ttttaaaagt tcatgttcat attgttgaag cacaattggg agaagttatt
     2881 caattgatta attctgatgg aaagaaaggt gttggtacta aattagcgac ggtattggat
     2941 ccaaatagta ctgaaccacc aactatcact gctgtcatgc caaaggattc ctctgccgca
     3001 actgcttcta atactaagcc taagattgaa atcgagaaaa cgccaccaac gagagatgct
     3061 tcccaagagc cgaataatgt tcaggttacg aacgtacgca aagtttcaca agaatcaaat
     3121 gccgaaagtg ttcaatcaat tcctcgtcca ggtggaatca ttgtgatgtc cccaacaaat
     3181 caaacagatt cggctccgcc cccaactgga gctgcagcaa aaccatcacg attccaagta
     3241 acaaagtcag cggatcctat agctacaccg atatcttcgt caatatccac agcaacagtt
     3301 atcccaattg ttgcagcaac acctacgaat atcacatccg aaccggtcat tgtccaacca
     3361 atcactgcac aagttataac ccatttggct acaccatcgc cagtttctca ttcgttatca
     3421 tcaaattctt ctccaagtgc tacaactcat tcgaatatgt catcaattca atcaacgact
     3481 agcgttcctg gaagacgatt cacagttcag cccgtctctc aagcagaatc cggaatatct
     3541 tcgtcaattt ctacgcctca tccggaaccg acgccagcaa tcacttcgtg tcctccacca
     3601 gttccaagtg tcccaccagt ggtgtccaat gggacattga acttagaagt tgctcctaaa
     3661 cagactccat cagcaactaa ccaaaatgtc gatacacaac attcatcgtc aacagcatca
     3721 acagctacat tagtttcgga gacacctgct acagtacatg ttactccgat ctcagtgcca
     3781 gctcctgttc aagaaccatt agtcatcgat catcattctg atgtattgac acaattggat
     3841 agtgagttga gaaaggtcag tggagtatca cactcggctt caccttcaac ggtagtcgag
     3901 tcgctcacct caatgactcc acaaacaatt ccattggctt gtcaaactgt gcccgcatcg
     3961 atcggtcaag ctccagcagt catcgcagct gcacacgcgg cgtcattaat tccaaatgca
     4021 agtgttccac agtcacctag tcgtcttgat gccgaaactg gacttgccgg tcttcacgag
     4081 aagcttgaag cgctgaaaat ggaacaggat cgacgagaag atatgggaga tgatgcgatt
     4141 ggcacaacaa ccacagacgg aaaggacgag ataccgattg atacgttaaa agggctcgcg
     4201 gaagcattag gaaaagttat tcatgcggat ggtagagaaa caacaccaat gccaccggat
     4261 catccggatt taacagatgc ttcaacgcaa caactcatct caccatctaa ccctgatgtt
     4321 ttgacaacga tgtcgtcggc tgtcgaagga tcagcatcat ccacaatgat agaagacatt
     4381 gatgcttcaa catcagcggt agacgcgtca atgatgaatt cgatgccgcc aggagctcag
     4441 aactctacag atcagatacc agcagcgatg acactgagta tggatcaaga atgtgctcaa
     4501 tcgatgacgt catcgataac aagaaacacg acaggcacca aattggcgac ttttgagaat
     4561 cttgaaacag ctctatcttc cacactcgga acacacattc gtcaaccgaa tgcaccgtct
     4621 tctcgagatg agacgacggc tccgatgaca ccaagtttca caaatgaaag aattggtggt
     4681 ggtggaggtg gtggagcaac atcatttagt ataggaacac cgcccagcca tagtccgttc
     4741 cctgtttcgg agtgtgatta tgatttgaag ggtcaaatgg atttggaaag cgaagatcct
     4801 gaggtgatcc agatgattgt tcgtcatcga atggaacaac acaaacttct cgaaaagcaa
     4861 cgtgtcgaga ttgagcgtct tcgttcgaaa attcgagttc cacgtgcaac ttctgtgaat
     4921 cccgaaatga ttggagatga tgaagctgat acgacgctta ctgctcttca aagtgcatta
     4981 ggcaatgctt cattgtcatt gccagccagt ccgccaccta atactgagac aacgaaggtc
     5041 aacaccactg taattccttc cgatgtattg gcgacccgaa tgacaatgtc tcaatcgtca
     5101 accaaatcaa gcaacgtctc ggtatcatcc cgtcatcgcg acaatcagtc cgctccgcca
     5161 cgtcatcatc accatcaacc ccaccctcct catcatccgc acctccaaaa tcactatcat
     5221 cccccacaaa atcatacgtc agccactgct ccttgtccat cggctatggt tcaactgcaa
     5281 gcagtgagca acaacaacgt gaaccctctc catcagccac cacatccagt ttcctctcag
     5341 atcccgccac aggcgtaa
//