Dbfetch

LOCUS       NM_001268447            5367 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase WNK (wnk-1),
            partial mRNA.
ACCESSION   NM_001268447
VERSION     NM_001268447.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5367)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5367)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5367)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5367)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5367
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>5367
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /db_xref="GeneID:177743"
                     /db_xref="WormBase:WBGene00006941"
     CDS             1..5367
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /standard_name="C46C2.1i"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase WNK"
                     /protein_id="NP_001255376.1"
                     /db_xref="GeneID:177743"
                     /db_xref="GOA:X5M5N0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024678"
                     /db_xref="UniProtKB/Swiss-Prot:X5M5N0"
                     /db_xref="WormBase:WBGene00006941"
                     /translation="MGSHWLSEQERSRLEAVQQDWRRTRPMKWTSKKRPDDPTTSSPS
                     TVSISNALENSTPSLNNVSSITNSSSPFSLSSAATSTASAIIPFTSNVATNHPHLNHH
                     VSRIPQAIVTGGTNGSLPPLLISPTSAAAATPLISGKAGPMSPSTGSPINVAATVLQN
                     AVSSPQHSIFDRSRLNKIPPNTSLASSSSPSDAANNDKPIQQRHSILSNVRTLTQAMV
                     NDGPRTLTGDDMDKMVSEEERARKEQEKREEEEKAARRIDVEDDFDAQEKPIDKSKNG
                     RFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQRFREEAEMLKDLQ
                     HPNIVRFYDYWESADLCGKRKYIVLVTELMTSGTLKMYLKRFKRINIKVLKSWCRQIL
                     KGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTPEFM
                     APEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIP
                     AQYPEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLNDLNVE
                     IQMQLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDEDTRMITK
                     LIKDKVDAFRRDRDHRLLEIKRAKEEEERIREEAEIKEELRLRAEAKEKEKERLEKER
                     LEKKAAAAAAANPNPTPIPPTPATPHSSAQQQPIPPPLSTQTSAEIQQSAQQPSVPVT
                     MIANIPAMSPTSAQPQPVLSPTSAAVPVPTTMIHVPKPSEIPVQNVATTAAPVAANNV
                     PPSPAPFKTEDIQTPTLAQNTVPRTISTDASGLVINTPASIASPSPAPSATDVASTTA
                     PVTPAPTPTTTTDGGAAAASTTTENKEEKRKSNKRKVVMEILGCDESRNFALVSCRLD
                     TSHKSVTFQFAPGTDKPCTIATKLLAEDCLLKVHVHIVEAQLGEVIQLINSDGKKGVG
                     TKLATVLDPNSTEPPTITAVMPKDSSAATASNTKPKIEIEKTPPTRDASQEPNNVQVT
                     NVRKVSQESNAESVQSIPRPGGIIVMSPTNQTDSAPPPTGAAAKPSRFQVTKSADPIA
                     TPISSSISTATVIPIVAATPTNITSEPVIVQPITAQVITHLATPSPVSHSLSSNSSPS
                     ATTHSNMSSIQSTTSVPGRRFTVQPVSQAESGISSSISTPHPEPTPAITSCPPPVPSV
                     PPVVSNGTLNLEVAPKQTPSATNQNVDTQHSSSTASTATLVSETPATVHVTPISVPAP
                     VQEPLVIDHHSDVLTQLDSELRKCFQVSGVSHSASPSTVVESLTSMTPQTIPLACQTV
                     PASIGQAPAVIAAAHAASLIPNASVPQSPSRLDAETGLAGLHEKLEALKMEQDRREDM
                     GDDAIGTTTTDGKDEIPIDTLKGLAEALGKVIHADGRETTPMPPDHPDLTDASTQQLI
                     SPSNPDVLTTMSSAVEGSASSTMIEDIDASTSAVDASMMNSMPPGAQNSTDQIPAAMT
                     LSMDQECAQSMTSSITRNTTGTKLATFENLETALSSTLGTHIRQPNAPSSRDETTAPM
                     TPSFTNERIGGGGGGGATSFSIGTPPSHSPFPVSECDYDLKGQMDLESEDPEVIQMIV
                     RHRMEQHKLLEKQRVEIERLRSKIRVPRATSVNPEMIGDDEADTTLTALQSALGNASL
                     SLPASPPPNTETTKVNTTVIPSDVLATRMTMSQSSTKSSNVSVSSRHRDNQSAPPRHH
                     HHQPHPPHHPHLQNHYHPPQNHTSATAPCPSAMVQLQAVSNNNVNPLHQPPHPVSSQI
                     PPQA"
ORIGIN      
        1 atgggatcac actggttgtc cgagcaagaa agatcacgac ttgaagctgt tcaacaggat
       61 tggcgaagaa ctcgaccaat gaaatggact tcaaaaaaga gaccagatga tccaacgaca
      121 tcatctccat cgacagtttc aattagtaat gcattggaaa attcaacacc ttcattaaac
      181 aatgtttctt cgatcacaaa ctcttcatca ccattttctt tatcgtcagc tgcaacatcg
      241 acagcttctg ccataatccc atttacctca aatgtagcta caaatcatcc acatcttaat
      301 caccacgtgt cgagaatacc acaggcgatt gtaacaggag ggacaaatgg ttcattacct
      361 ccattattaa tatcaccgac gtcagcagca gccgcaacgc cgttgatttc aggaaaagcg
      421 ggtccaatgt caccatcaac gggaagtcca attaatgtgg ctgctacagt attacagaat
      481 gcagtttcaa gtccacaaca tagtattttt gatagatcta ggttaaataa aattccacca
      541 aacacatcat tagcatcgtc ttcgtctccg agtgatgctg ctaacaatga taaacctata
      601 caacaacgtc atagtatttt atcgaatgtt cgaactctca ctcaagcaat ggtaaacgat
      661 ggaccacgaa cgttgactgg agatgatatg gacaagatgg tcagtgaaga ggaaagagca
      721 cgaaaagagc aagagaagcg agaagaagaa gagaaagcag cacggagaat tgatgttgaa
      781 gatgattttg atgcgcaaga aaaacccatt gataagagta aaaatggtcg attcttaaag
      841 ttcgacgaag aacttggtcg cggatcgttc aagacagtgt ttcgagggtt ggacactgaa
      901 accggagtgg ccgttgcgtg gtgtgagctt caggagagta aactgaataa gactgaaagg
      961 caacgttttc gagaagaagc tgaaatgctc aaggatctgc aacatccgaa catcgtacga
     1021 ttctacgatt attgggagag tgcggatttg tgtggaaaac ggaaatatat tgtgcttgta
     1081 accgaattga tgacttcagg aacattaaaa atgtatttga agcgatttaa acggataaac
     1141 ataaaggtat tgaaatcttg gtgcagacaa attctgaaag ggctttcatt tcttcacaca
     1201 cgtaatccac ctgtaattca tcgtgatctc aagtgtgata atatctttat cactggtaca
     1261 actggtagtg taaagattgg agatcttgga ttggcaactc ttaaaaataa atcattcgcg
     1321 aaatctgtca ttggaactcc agaattcatg gcaccggaaa tgtacgaaga gatgtatgat
     1381 gagagtgtag atgtctacgc gtttggaatg tgtcttcttg aaatggttac cggagaatat
     1441 ccatattctg agtgtatgaa tccagcgaca atctacagaa aagtgatatc aggtgtcaaa
     1501 ccagaatgtt tctcaagaat tcctgcacaa tatcctgaaa tacgtgagat aatcgatcgg
     1561 tgtattcgtg tgagacgaga agagagaagt accgtgaagc aattgctcgt tgacgatttc
     1621 ttcactccag aagatctcat cggaattcgt gttgaaatta agaatcggga tgctgatctc
     1681 aatgatctta acgtggaaat tcaaatgcaa ctccgagttt acgatgagaa aaagagaaaa
     1741 caatatcggt tcaaggagaa cgaaggactt caatttgcat ttgatattga aaatgacagc
     1801 ccagatgaag ttgttcaaca gatgatcgag caacaacata ttccagatga ggatactcga
     1861 atgataacaa agttgataaa agacaaagtg gatgcgttca gaagagatcg agatcatcgt
     1921 ttattggaga ttaaaagagc aaaagaggag gaagaaagga tacgagaaga ggctgagatt
     1981 aaagaggaat tgaggttgag agctgaagct aaagaaaagg aaaaggagag gttggagaaa
     2041 gaacgattag aaaaaaaagc tgcagctgcg gccgcagcca atccgaatcc tacaccaatt
     2101 ccaccaactc cagcaacacc acactcttct gcccaacaac agcctattcc accaccacta
     2161 tcaactcaaa cttcggctga aatacagcag tctgctcaac agccatctgt acctgtaact
     2221 atgatcgcaa atatcccagc tatgtcgcca acatcagctc aaccacaacc tgttttatca
     2281 ccaacaagtg cagcggttcc agttccaacg acaatgattc atgttccaaa acctagcgag
     2341 attccagtgc agaatgtagc gacgactgca gccccggttg cggctaacaa tgtaccacca
     2401 tcaccagctc cattcaaaac agaagatatc caaactccca cacttgccca gaatacggtt
     2461 ccacgaacaa tctccactga tgcttctgga cttgtcatca atactcctgc atcaatagca
     2521 tcaccatcac ctgctccttc ggctactgat gttgcttcaa caacggctcc agtcacccct
     2581 gctccaactc caacaacaac aacggacggt ggtgcagcag cagcttcaac aacaactgaa
     2641 aacaaggaag aaaagcgaaa aagcaacaaa agaaaagtgg taatggagat tttgggatgt
     2701 gatgaatcga ggaattttgc attggtctcg tgtcgacttg acacttctca taaatctgtt
     2761 accttccaat ttgcaccagg aactgacaaa ccatgcacaa ttgcaacgaa acttttggct
     2821 gaagattgtc ttttaaaagt tcatgttcat attgttgaag cacaattggg agaagttatt
     2881 caattgatta attctgatgg aaagaaaggt gttggtacta aattagcgac ggtattggat
     2941 ccaaatagta ctgaaccacc aactatcact gctgtcatgc caaaggattc ctctgccgca
     3001 actgcttcta atactaagcc taagattgaa atcgagaaaa cgccaccaac gagagatgct
     3061 tcccaagagc cgaataatgt tcaggttacg aacgtacgca aagtttcaca agaatcaaat
     3121 gccgaaagtg ttcaatcaat tcctcgtcca ggtggaatca ttgtgatgtc cccaacaaat
     3181 caaacagatt cggctccgcc cccaactgga gctgcagcaa aaccatcacg attccaagta
     3241 acaaagtcag cggatcctat agctacaccg atatcttcgt caatatccac agcaacagtt
     3301 atcccaattg ttgcagcaac acctacgaat atcacatccg aaccggtcat tgtccaacca
     3361 atcactgcac aagttataac ccatttggct acaccatcgc cagtttctca ttcgttatca
     3421 tcaaattctt ctccaagtgc tacaactcat tcgaatatgt catcaattca atcaacgact
     3481 agcgttcctg gaagacgatt cacagttcag cccgtctctc aagcagaatc cggaatatct
     3541 tcgtcaattt ctacgcctca tccggaaccg acgccagcaa tcacttcgtg tcctccacca
     3601 gttccaagtg tcccaccagt ggtgtccaat gggacattga acttagaagt tgctcctaaa
     3661 cagactccat cagcaactaa ccaaaatgtc gatacacaac attcatcgtc aacagcatca
     3721 acagctacat tagtttcgga gacacctgct acagtacatg ttactccgat ctcagtgcca
     3781 gctcctgttc aagaaccatt agtcatcgat catcattctg atgtattgac acaattggat
     3841 agtgagttga gaaagtgttt tcaggtcagt ggagtatcac actcggcttc accttcaacg
     3901 gtagtcgagt cgctcacctc aatgactcca caaacaattc cattggcttg tcaaactgtg
     3961 cccgcatcga tcggtcaagc tccagcagtc atcgcagctg cacacgcggc gtcattaatt
     4021 ccaaatgcaa gtgttccaca gtcacctagt cgtcttgatg ccgaaactgg acttgccggt
     4081 cttcacgaga agcttgaagc gctgaaaatg gaacaggatc gacgagaaga tatgggagat
     4141 gatgcgattg gcacaacaac cacagacgga aaggacgaga taccgattga tacgttaaaa
     4201 gggctcgcgg aagcattagg aaaagttatt catgcggatg gtagagaaac aacaccaatg
     4261 ccaccggatc atccggattt aacagatgct tcaacgcaac aactcatctc accatctaac
     4321 cctgatgttt tgacaacgat gtcgtcggct gtcgaaggat cagcatcatc cacaatgata
     4381 gaagacattg atgcttcaac atcagcggta gacgcgtcaa tgatgaattc gatgccgcca
     4441 ggagctcaga actctacaga tcagatacca gcagcgatga cactgagtat ggatcaagaa
     4501 tgtgctcaat cgatgacgtc atcgataaca agaaacacga caggcaccaa attggcgact
     4561 tttgagaatc ttgaaacagc tctatcttcc acactcggaa cacacattcg tcaaccgaat
     4621 gcaccgtctt ctcgagatga gacgacggct ccgatgacac caagtttcac aaatgaaaga
     4681 attggtggtg gtggaggtgg tggagcaaca tcatttagta taggaacacc gcccagccat
     4741 agtccgttcc ctgtttcgga gtgtgattat gatttgaagg gtcaaatgga tttggaaagc
     4801 gaagatcctg aggtgatcca gatgattgtt cgtcatcgaa tggaacaaca caaacttctc
     4861 gaaaagcaac gtgtcgagat tgagcgtctt cgttcgaaaa ttcgagttcc acgtgcaact
     4921 tctgtgaatc ccgaaatgat tggagatgat gaagctgata cgacgcttac tgctcttcaa
     4981 agtgcattag gcaatgcttc attgtcattg ccagccagtc cgccacctaa tactgagaca
     5041 acgaaggtca acaccactgt aattccttcc gatgtattgg cgacccgaat gacaatgtct
     5101 caatcgtcaa ccaaatcaag caacgtctcg gtatcatccc gtcatcgcga caatcagtcc
     5161 gctccgccac gtcatcatca ccatcaaccc caccctcctc atcatccgca cctccaaaat
     5221 cactatcatc ccccacaaaa tcatacgtca gccactgctc cttgtccatc ggctatggtt
     5281 caactgcaag cagtgagcaa caacaacgtg aaccctctcc atcagccacc acatccagtt
     5341 tcctctcaga tcccgccaca ggcgtaa
//