Dbfetch

LOCUS       NM_001268441            5523 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase WNK (wnk-1),
            partial mRNA.
ACCESSION   NM_001268441
VERSION     NM_001268441.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5523)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5523)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5523)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5523)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5523
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>5523
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /db_xref="GeneID:177743"
                     /db_xref="WormBase:WBGene00006941"
     CDS             1..5523
                     /gene="wnk-1"
                     /locus_tag="CELE_C46C2.1"
                     /standard_name="C46C2.1d"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase WNK"
                     /protein_id="NP_001255370.1"
                     /db_xref="GeneID:177743"
                     /db_xref="GOA:X5M5N0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024678"
                     /db_xref="UniProtKB/Swiss-Prot:X5M5N0"
                     /db_xref="WormBase:WBGene00006941"
                     /translation="MPDSITNGGRPPAPPSSVSSTTASTTGNFGTRRRLVNRIKKVDE
                     LHPAQENPTMGSHWLSEQERSRLEAVQQDWRRTRPMKFQWTSKKRPDDPTTSSPSTVS
                     ISNALENSTPSLNNVSSITNSSSPFSLSSAATSTASAIIPFTSNVATNHPHLNHHVSR
                     IPQAIVTGGTNGSLPPLLISPTSAAAATPLISGKAGPMSPSTGSPINVAATVLQNAVS
                     SPQHSIFDRSRLNKIPPNTSLASSSSPSDAANNDKPIQQRHSILSNVRTLTQAMVNDG
                     PRTLTGDDMDKMVSEEERARKEQEKREEEEKAARRIDVEDDFDAQEKPIDKSKNGRFL
                     KFDEELGRGSFKTVFRGLDTETGVAVAWCELQESKLNKTERQRFREEAEMLKDLQHPN
                     IVRFYDYWESADLCGKRKYIVLVTELMTSGTLKMYLKRFKRINIKVLKSWCRQILKGL
                     SFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTPEFMAPE
                     MYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQY
                     PEIREIIDRCIRVRREERSTVKQLLVDDFFTPEDLIGIRVEIKNRDADLNDLNVEIQM
                     QLRVYDEKKRKQYRFKENEGLQFAFDIENDSPDEVVQQMIEQQHIPDEDTRMITKLIK
                     DKVDAFRRDRDHRLLEIKRAKEEEERIREEAEIKEELRLRAEAKEKEKERLEKERLEK
                     KAAAAAAANPNPTPIPPTPATPHSSAQQQPIPPPLSTQTSAEIQQSAQQPSVPVTMIA
                     NIPAMSPTSAQPQPVLSPTSAAVPVPTTMIHVPKPSEIPVQNVATTAAPVAANNVPPS
                     PAPFKTEDIQTPTLAQNTVPRTISTDASGLVINTPASIASPSPAPSATDVASTTAPVT
                     PAPTPTTTTDGGAAAASTTTENKEEKRKSNKRKVVMEILGCDESRNFALVSCRLDTSH
                     KSVTFQFAPGTDKPCTIATKLLAEDCLLKVHVHIVEAQLGEVIQLINSDGKKGVGTKL
                     ATVLDPNSTEPPTITAVMPKDSSAATASNTKPKIEIEKTPPTRDASQEPNNVQVTNVR
                     KVSQESNAESVQSIPRPGGIIVMSPTNQTDSAPPPTGAAAKPSRFQVTKSADPIATPI
                     SSSISTATVIPIVAATPTNITSEPVIVQPITAQVITHLATPSPVSHSLSSNSSPSATT
                     HSNMSSIQSTTSVPGRRFTVQPVSQAESGISSSISTPHPEPTPAITSCPPPVPSVPPV
                     VSNGTLNLEVAPKQTPSATNQNVDTQHSSSTASTATLVSETPATVHVTPISVPAPVQE
                     PLVIDHHSDVLTQLDSELRKVSGVSHSASPSTVVESLTSMTPQTIPLACQTVPASIGQ
                     APAVIAAAHAASLIPNASVPQSPSRLDAETGLAGLHEKLEALKMEQDRREDMGDDAIG
                     TTTTDGKDEIPIDTLKGLAEALGKVIHADGRETTPMPPDHPDLTDASTQQLISPSNPD
                     VLTTMSSAVEGSASSTMIEDIDASTSAVDASMMNSMPPGAQNSTDQIPAAMTLSMDQE
                     CAQSMTSSITRNTTGTKLATFENLETALSSTLGTHIRQPNAPSSRDETTAPMTPSFTN
                     ERIGGGGGGGATSFSIGTPPSHSPFPVSECDYDLKGQMDLESEDPEVIQMIVRHRMEQ
                     HKLLEKQRVEIERLRSKIRVPRATSVNPEMIGDDEADTTLTALQSALGNASLSLPASP
                     PPNTETTKVNTTVIPSDVLATRMTMSQSSTKSSNVSVSSRHRDNQSAPPRHHHHQPHP
                     PHHPHLQNHYHPPQNHTSATAPCPSAMVQLQAVSNNNVNPLHQPPHPVSSQIPPQA"
ORIGIN      
        1 atgcctgatt ctataacaaa cggtggacga ccaccagcac ctccaagctc tgtgagctca
       61 acaacagcat cgacaactgg taattttggt actcgacgtc gtttagtgaa tcgtatcaag
      121 aaagtcgatg aactacatcc agcacaagag aatcccacaa tgggatcaca ctggttgtcc
      181 gagcaagaaa gatcacgact tgaagctgtt caacaggatt ggcgaagaac tcgaccaatg
      241 aaatttcagt ggacttcaaa aaagagacca gatgatccaa cgacatcatc tccatcgaca
      301 gtttcaatta gtaatgcatt ggaaaattca acaccttcat taaacaatgt ttcttcgatc
      361 acaaactctt catcaccatt ttctttatcg tcagctgcaa catcgacagc ttctgccata
      421 atcccattta cctcaaatgt agctacaaat catccacatc ttaatcacca cgtgtcgaga
      481 ataccacagg cgattgtaac aggagggaca aatggttcat tacctccatt attaatatca
      541 ccgacgtcag cagcagccgc aacgccgttg atttcaggaa aagcgggtcc aatgtcacca
      601 tcaacgggaa gtccaattaa tgtggctgct acagtattac agaatgcagt ttcaagtcca
      661 caacatagta tttttgatag atctaggtta aataaaattc caccaaacac atcattagca
      721 tcgtcttcgt ctccgagtga tgctgctaac aatgataaac ctatacaaca acgtcatagt
      781 attttatcga atgttcgaac tctcactcaa gcaatggtaa acgatggacc acgaacgttg
      841 actggagatg atatggacaa gatggtcagt gaagaggaaa gagcacgaaa agagcaagag
      901 aagcgagaag aagaagagaa agcagcacgg agaattgatg ttgaagatga ttttgatgcg
      961 caagaaaaac ccattgataa gagtaaaaat ggtcgattct taaagttcga cgaagaactt
     1021 ggtcgcggat cgttcaagac agtgtttcga gggttggaca ctgaaaccgg agtggccgtt
     1081 gcgtggtgtg agcttcagga gagtaaactg aataagactg aaaggcaacg ttttcgagaa
     1141 gaagctgaaa tgctcaagga tctgcaacat ccgaacatcg tacgattcta cgattattgg
     1201 gagagtgcgg atttgtgtgg aaaacggaaa tatattgtgc ttgtaaccga attgatgact
     1261 tcaggaacat taaaaatgta tttgaagcga tttaaacgga taaacataaa ggtattgaaa
     1321 tcttggtgca gacaaattct gaaagggctt tcatttcttc acacacgtaa tccacctgta
     1381 attcatcgtg atctcaagtg tgataatatc tttatcactg gtacaactgg tagtgtaaag
     1441 attggagatc ttggattggc aactcttaaa aataaatcat tcgcgaaatc tgtcattgga
     1501 actccagaat tcatggcacc ggaaatgtac gaagagatgt atgatgagag tgtagatgtc
     1561 tacgcgtttg gaatgtgtct tcttgaaatg gttaccggag aatatccata ttctgagtgt
     1621 atgaatccag cgacaatcta cagaaaagtg atatcaggtg tcaaaccaga atgtttctca
     1681 agaattcctg cacaatatcc tgaaatacgt gagataatcg atcggtgtat tcgtgtgaga
     1741 cgagaagaga gaagtaccgt gaagcaattg ctcgttgacg atttcttcac tccagaagat
     1801 ctcatcggaa ttcgtgttga aattaagaat cgggatgctg atctcaatga tcttaacgtg
     1861 gaaattcaaa tgcaactccg agtttacgat gagaaaaaga gaaaacaata tcggttcaag
     1921 gagaacgaag gacttcaatt tgcatttgat attgaaaatg acagcccaga tgaagttgtt
     1981 caacagatga tcgagcaaca acatattcca gatgaggata ctcgaatgat aacaaagttg
     2041 ataaaagaca aagtggatgc gttcagaaga gatcgagatc atcgtttatt ggagattaaa
     2101 agagcaaaag aggaggaaga aaggatacga gaagaggctg agattaaaga ggaattgagg
     2161 ttgagagctg aagctaaaga aaaggaaaag gagaggttgg agaaagaacg attagaaaaa
     2221 aaagctgcag ctgcggccgc agccaatccg aatcctacac caattccacc aactccagca
     2281 acaccacact cttctgccca acaacagcct attccaccac cactatcaac tcaaacttcg
     2341 gctgaaatac agcagtctgc tcaacagcca tctgtacctg taactatgat cgcaaatatc
     2401 ccagctatgt cgccaacatc agctcaacca caacctgttt tatcaccaac aagtgcagcg
     2461 gttccagttc caacgacaat gattcatgtt ccaaaaccta gcgagattcc agtgcagaat
     2521 gtagcgacga ctgcagcccc ggttgcggct aacaatgtac caccatcacc agctccattc
     2581 aaaacagaag atatccaaac tcccacactt gcccagaata cggttccacg aacaatctcc
     2641 actgatgctt ctggacttgt catcaatact cctgcatcaa tagcatcacc atcacctgct
     2701 ccttcggcta ctgatgttgc ttcaacaacg gctccagtca cccctgctcc aactccaaca
     2761 acaacaacgg acggtggtgc agcagcagct tcaacaacaa ctgaaaacaa ggaagaaaag
     2821 cgaaaaagca acaaaagaaa agtggtaatg gagattttgg gatgtgatga atcgaggaat
     2881 tttgcattgg tctcgtgtcg acttgacact tctcataaat ctgttacctt ccaatttgca
     2941 ccaggaactg acaaaccatg cacaattgca acgaaacttt tggctgaaga ttgtctttta
     3001 aaagttcatg ttcatattgt tgaagcacaa ttgggagaag ttattcaatt gattaattct
     3061 gatggaaaga aaggtgttgg tactaaatta gcgacggtat tggatccaaa tagtactgaa
     3121 ccaccaacta tcactgctgt catgccaaag gattcctctg ccgcaactgc ttctaatact
     3181 aagcctaaga ttgaaatcga gaaaacgcca ccaacgagag atgcttccca agagccgaat
     3241 aatgttcagg ttacgaacgt acgcaaagtt tcacaagaat caaatgccga aagtgttcaa
     3301 tcaattcctc gtccaggtgg aatcattgtg atgtccccaa caaatcaaac agattcggct
     3361 ccgcccccaa ctggagctgc agcaaaacca tcacgattcc aagtaacaaa gtcagcggat
     3421 cctatagcta caccgatatc ttcgtcaata tccacagcaa cagttatccc aattgttgca
     3481 gcaacaccta cgaatatcac atccgaaccg gtcattgtcc aaccaatcac tgcacaagtt
     3541 ataacccatt tggctacacc atcgccagtt tctcattcgt tatcatcaaa ttcttctcca
     3601 agtgctacaa ctcattcgaa tatgtcatca attcaatcaa cgactagcgt tcctggaaga
     3661 cgattcacag ttcagcccgt ctctcaagca gaatccggaa tatcttcgtc aatttctacg
     3721 cctcatccgg aaccgacgcc agcaatcact tcgtgtcctc caccagttcc aagtgtccca
     3781 ccagtggtgt ccaatgggac attgaactta gaagttgctc ctaaacagac tccatcagca
     3841 actaaccaaa atgtcgatac acaacattca tcgtcaacag catcaacagc tacattagtt
     3901 tcggagacac ctgctacagt acatgttact ccgatctcag tgccagctcc tgttcaagaa
     3961 ccattagtca tcgatcatca ttctgatgta ttgacacaat tggatagtga gttgagaaag
     4021 gtcagtggag tatcacactc ggcttcacct tcaacggtag tcgagtcgct cacctcaatg
     4081 actccacaaa caattccatt ggcttgtcaa actgtgcccg catcgatcgg tcaagctcca
     4141 gcagtcatcg cagctgcaca cgcggcgtca ttaattccaa atgcaagtgt tccacagtca
     4201 cctagtcgtc ttgatgccga aactggactt gccggtcttc acgagaagct tgaagcgctg
     4261 aaaatggaac aggatcgacg agaagatatg ggagatgatg cgattggcac aacaaccaca
     4321 gacggaaagg acgagatacc gattgatacg ttaaaagggc tcgcggaagc attaggaaaa
     4381 gttattcatg cggatggtag agaaacaaca ccaatgccac cggatcatcc ggatttaaca
     4441 gatgcttcaa cgcaacaact catctcacca tctaaccctg atgttttgac aacgatgtcg
     4501 tcggctgtcg aaggatcagc atcatccaca atgatagaag acattgatgc ttcaacatca
     4561 gcggtagacg cgtcaatgat gaattcgatg ccgccaggag ctcagaactc tacagatcag
     4621 ataccagcag cgatgacact gagtatggat caagaatgtg ctcaatcgat gacgtcatcg
     4681 ataacaagaa acacgacagg caccaaattg gcgacttttg agaatcttga aacagctcta
     4741 tcttccacac tcggaacaca cattcgtcaa ccgaatgcac cgtcttctcg agatgagacg
     4801 acggctccga tgacaccaag tttcacaaat gaaagaattg gtggtggtgg aggtggtgga
     4861 gcaacatcat ttagtatagg aacaccgccc agccatagtc cgttccctgt ttcggagtgt
     4921 gattatgatt tgaagggtca aatggatttg gaaagcgaag atcctgaggt gatccagatg
     4981 attgttcgtc atcgaatgga acaacacaaa cttctcgaaa agcaacgtgt cgagattgag
     5041 cgtcttcgtt cgaaaattcg agttccacgt gcaacttctg tgaatcccga aatgattgga
     5101 gatgatgaag ctgatacgac gcttactgct cttcaaagtg cattaggcaa tgcttcattg
     5161 tcattgccag ccagtccgcc acctaatact gagacaacga aggtcaacac cactgtaatt
     5221 ccttccgatg tattggcgac ccgaatgaca atgtctcaat cgtcaaccaa atcaagcaac
     5281 gtctcggtat catcccgtca tcgcgacaat cagtccgctc cgccacgtca tcatcaccat
     5341 caaccccacc ctcctcatca tccgcacctc caaaatcact atcatccccc acaaaatcat
     5401 acgtcagcca ctgctccttg tccatcggct atggttcaac tgcaagcagt gagcaacaac
     5461 aacgtgaacc ctctccatca gccaccacat ccagtttcct ctcagatccc gccacaggcg
     5521 taa
//