Dbfetch

LOCUS       NM_001268249            4788 bp    mRNA    linear   INV 27-MAY-2020
DEFINITION  Caenorhabditis elegans HUN domain-containing protein (pqn-80),
            mRNA.
ACCESSION   NM_001268249
VERSION     NM_001268249.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4788)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4788)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAY-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4788)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (21-APR-2020) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4788)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Sep 4, 2019 this sequence version replaced NM_001268249.1.
FEATURES             Location/Qualifiers
     source          1..4788
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..4788
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             8..4258
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="HUN domain-containing protein"
                     /protein_id="NP_001255178.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14a.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14a.2"
                     /db_xref="GeneID:176683"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:C7IVS5"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MDSLGSSKKKKKAEKSAKNEVIQIRISVAKPGSKKYTHVDWEEL
                     LKNNGKERDEDDLRRFYDEDTLFMAKKLGETRSKSGKKLRVNLDQLQHFNRKCGYDMD
                     DDFIDDTEIVDDEPTTSKKGGFYVGKGDVKDSNDEDEEEEEETDVEESIQEVPKKVKI
                     RKIKEKSGEKSSKSSDSSSSSSSDSEDAAGPPRMTGAPPSIRMVSSSSSLKKLPAPRK
                     PSPPPAVEPTRSVEIIEKPEKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIIL
                     IDDNAPAAKKQPESAQKGSTTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTAST
                     PKKEEIGTLETFLKNIFANLDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKV
                     NMEPLIYSLAKSFGMTTQEVMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAA
                     DWKLTQTDLPTMGEKDIQMLTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKK
                     FFDIINTLPDSSEKNGGGGQQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLK
                     HHSPPVEGLAKKQVIAANAIKEGVRKQISLFENKKDRLPGDPVYVFQFTEPVLTAVAP
                     YLEDLVDYALAAKKIELIVSGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVEEPM
                     KSRLKEANEQIMKHQVVQIPKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAAKPS
                     APATPKASSSTALRPSTSSTPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQVYAG
                     KYLLPTGNSTADICDPTICLMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVGQTR
                     MAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKE
                     KEKQAEKDRIEAKKFEERMKKEQEKQEEKERKEREKREEKERKEREIREIMERKKREE
                     DDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETERKVAEARRAVERENQIKM
                     MRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDHSFDILKEAEKDAHIIPTKSIKA
                     EPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQ
                     YNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPH
                     QNPQIATSSSSGGVNQFYNNGGAAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPI
                     NSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPMSQRFHTPPSVGHQM
                     VQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQY
                     QHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 agacaaaatg gactcattgg gtagctcaaa gaagaagaaa aaagccgaaa agagcgcgaa
       61 aaacgaggtt attcaaattc gcatcagtgt cgcgaagccg ggcagcaaga aatacactca
      121 tgtcgattgg gaggaactgc tgaagaataa tggaaaagag cgggacgaag atgatctccg
      181 cagattttac gatgaagaca cactttttat ggcaaaaaag ctcggggaga cgagaagcaa
      241 aagtggaaag aaacttcgcg ttaatttgga ccagctgcaa catttcaacc gaaagtgtgg
      301 atatgatatg gatgatgact ttattgatga cacagaaata gttgacgacg agcctacaac
      361 atcgaaaaag ggtggatttt atgtgggaaa gggtgatgtg aaggattcaa acgacgagga
      421 tgaggaagaa gaagaagaaa ccgatgtgga agaatcgatt caggaagttc cgaagaaggt
      481 gaaaatcagg aaaatcaaag agaaatctgg cgaaaaatcc agtaaatcca gtgattcttc
      541 atcatcctcc tcgtccgatt cggaggatgc tgctgggcct ccgagaatga caggagctcc
      601 accgtcaatt cgaatggttt cttcttcttc ttctttgaag aagcttccgg cccctcgaaa
      661 accatccccg ccgccggctg tagagcccac aagatctgtg gaaattattg agaagcctga
      721 aaagactgaa aagcccgccg aaaagcgaaa aaccgcggcc accacatccg cactggagcc
      781 tgctgaaaag aagaaaaagc cggatagtag tagtagttcg gaggagataa ttcttattga
      841 tgataatgct ccggctgcaa agaagcagcc ggaaagtgct caaaaagggt ccaccacagt
      901 caccatgtca gccaagaaaa tctgcaaaca acaggaagaa atcgctaagc agaagccgtc
      961 atcatcatct gtaactccat caaaaccagc tgctccaaca gcttcaacac cgaaaaaaga
     1021 ggaaatcggg actcttgaga cgttcctgaa gaatatattt gcaaatttag atgcaaaagg
     1081 gaaactttat caggagaaaa agttgaaaac tttcgatacg gagactttaa aggagataac
     1141 aacgtttata gatgtaatga agcatcataa aactgaaaaa gttaatatgg aaccgttgat
     1201 ttattcgttg gcgaaatcat ttggaatgac tacgcaagaa gttatgaaac aggtcgaaca
     1261 agaaatttcg tcgaaaaagg caacaactcc aaaaccttca acaaatgcag ttttatcgac
     1321 aatttcatct caaaaatcat tggaaaaaaa tgcagccgat tggaaattaa cacaaacgga
     1381 tttacccaca atgggagaaa aagatataca aatgttgacg acaattgttc gatcatggaa
     1441 aagtaaaaaa gaaatatcga attcaatggt gactggatgg ctgaaagatg tgaatcaatt
     1501 gaaaatgaac gcagatcaag cgaggaaaaa attcttcgac atcataaata ctttgccgga
     1561 ttcgtctgaa aaaaatggtg gtggtggaca gcaagatgcc aacgatattc caaaacacga
     1621 acgatcacgt aaagctcgaa tgtttctcca ccaatgggtc tatttatctc gtaaattttt
     1681 ggagcttcaa cttccaaaat tgaaacatca ttctccacct gtcgaaggtc tcgcaaagaa
     1741 gcaagttatc gctgcaaatg caataaaaga aggtgttagg aagcaaattt cactttttga
     1801 aaataagaaa gatcgtctgc ccggtgatcc tgtctacgta ttccagttta cggagcctgt
     1861 tttaaccgca gtcgccccat acttggaaga tctcgtcgat tatgcgctcg cggcgaaaaa
     1921 aatcgagtta attgtatccg gaatcgacgc tctacaccaa tcaactgacg gaaaaattac
     1981 cataattcaa ttttatattg aaatctgccg aagacttcag aaattatcat ttctcgccgt
     2041 tgaagaacca atgaaaagtc gtctgaaaga agcaaatgaa caaattatga agcatcaagt
     2101 tgttcaaatt ccaaaatatc aattgaaatg gcctgatgga caggcggagc catctctgaa
     2161 agggcttaat cgagagcttt atgaattcga caaatcaatt ctctccatgg tggcggctaa
     2221 accatcagct cctgcaactc caaaagcttc atcatctaca gccctccgcc cttctacgtc
     2281 atcaactcca tctcagcagc aatccacgtc aactgcaaaa gctatgacgt catcatcaac
     2341 atcagcagaa gatgcgaagc gcttactcgc aatgaatcaa cttgttcagg tttacgcggg
     2401 aaaatatctg ctcccgaccg gcaattcaac ggcagacatt tgtgatccaa caatttgtct
     2461 aatgaatgat gatattctac tgattatggt aacagctgtc tattcgtgtg gtataccatt
     2521 ggttaatcaa atgaatatgc ttaaaaatgt cctatgccaa gttggtcaaa cccgaatggc
     2581 tcagacattg gcaacacaaa aaactcaaaa taagcagtgc ctgacccaaa atgactatca
     2641 actacttttt gattattttg gaaagtttga aaaagcatta gaacaacgaa aagcaaaaaa
     2701 agaagaagct gaaagattga agaaattgga ggaaaaattg aaaaaagaga aggagaaaca
     2761 agcagagaaa gatagaattg aggcgaagaa attcgaagag cggatgaaaa aagagcaaga
     2821 aaaacaggaa gaaaaagaga gaaaagaacg ggaaaaacga gaggaaaagg aaaggaaaga
     2881 gagagaaatt cgagaaatta tggagaggaa aaagagagaa gaagacgatc gaattgctgc
     2941 gaaattacaa attgctcaac aattagagaa tgacaggaaa atgagagaag ctgaagaaag
     3001 tgcacggaag gagacggaac ggagggctaa aatggaaact gaacgaaaag tggcggaagc
     3061 tcggcgagca gttgaacgtg agaatcagat caaaatgatg agggctcaac agctgcaaag
     3121 acggcaggaa gaggctccgc cccctcaaca agctccagct ccacatacac aaaagattca
     3181 agtgaaaaat gagccagtag atcattcatt cgatattcta aaagaagcag aaaaagatgc
     3241 acacataatt ccaacaaaat caataaaagc cgagccgctg gacgttcaaa aaccgcttag
     3301 cgcatttgaa aagcttgcat cacttcgtgg taggacccaa tctgctgata tgagaagagg
     3361 cggggactct acggaaatgc cgaatgtgac acaacaatat caagcggagc aaaatcatct
     3421 agcacaaagt tcgaataatt ctcagtacaa tgcaccaagt acaagttccc agccacaaca
     3481 tttcccaaca gagccttcaa tacgccaacc acctccccaa cagagttaca attccaacca
     3541 aatgctccaa aatccacgac agcaacccca aaaccaaatt gtgcaaaatt tccaaagtgc
     3601 tccgcaacga catccccatc aaaatccgca aattgccacg tcatcttcat ctggaggagt
     3661 caatcagttt tataataatg gtggagctgc accgccagtt gtcgaacaac aagccgctaa
     3721 tagaagatca tcattcacaa tgtctcattc agttcaacaa caccaatctc ctctccaaca
     3781 acaatttcca atcaattcat atcaatcacc gagtcatcat aataatagta gctcaatgag
     3841 caattcctca ttaatgcaaa caccacacag taatagttca atgattgcac ggagtccaca
     3901 atttccatct catacgtccc caatgtccca acgattccat accccaccat cagttgggca
     3961 tcaaatggtg cagagcccat tgtctcaacc gaatccttcg cctcttcaac atttcaactt
     4021 ttcgccacat tcctccagtt tttcatcaca aagacctcaa atgccgccac aacgtcaaat
     4081 gagccaacaa aatctcatgc atcaacagca acaaccacaa aatcatactc aacatcagta
     4141 ccaacatcag acattcagtt ctcagcaaca acagcttcaa caacatcaac accaaatccg
     4201 gcaccaaatg aataccaact acccaccgcc accaggctac aatcatcatg gccattaact
     4261 cttccaggag aagtaaaaca ttttaaatct cgtgtaaaca attgtaaacg ccaaaagtaa
     4321 aatccgtcaa acggttaata atattattct attacgagaa cactaaactc taagaatgcg
     4381 tattacacaa catatttgac gcgcaaaaaa taactatatc tcgtagcgaa aactacagta
     4441 attctttgaa tgattactgt agcgcaattt agaaaattta gaaaatcgaa aaattcaaaa
     4501 gttttctgaa ttaagattta gttaagtaaa tttaaaatgt ttcaattttt aatattctat
     4561 cgataaataa attattttat tctattcgag cccgtaaatc gacgctaccg tagttttcgc
     4621 tacgagatat tttgcgcgtc aaatatgttg cacaatacgc attctcagaa tttatgtctt
     4681 cccgtagtaa acctccatgt taattatttc ccaatttatt tattttatgt gtttcatggc
     4741 attaatttta tatgttatca attttaaata aatatctcga aaacttta
//