Dbfetch

LOCUS       NM_001267976            1261 bp    mRNA    linear   INV 18-OCT-2019
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), mRNA.
ACCESSION   NM_001267976
VERSION     NM_001267976.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1261)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1261)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1261)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1261)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Sep 4, 2019 this sequence version replaced NM_001267976.1.
FEATURES             Location/Qualifiers
     source          1..1261
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..1261
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             102..983
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2p"
                     /note="Product from WormBase gene class sup;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254905.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2p.1"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2p.2"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCQ9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCQ9"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRV
                     QNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSVSSRRVPLPPTSQHRASSNFNT
                     TPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQA
                     AAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTR
                     ILRTPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGRKSKL
                     SGRTDGVFEWPALDEQS"
ORIGIN      
        1 agcacattgc tttcgaacgg cccatctacc gtcttcactt aaccatctac tctcttaata
       61 accaacccaa agatcaataa aactatcaag aaccaagaag aatgaacgca tcttcggctc
      121 cacaacaaca acagcaacaa cagcagccac aacaagggca agctccccag caacaacaac
      181 agggaccacc acaacatcaa tatcaacaac aacgcccatt ccatggacgt gtccaaaacc
      241 atatgagagg aagcggaccg tttggaaaca gcaacggcta tggtcgttac acagctccac
      301 gtggtgacca gcagcatcac gactcgactc ctttgagctc ggtgagttcg cgtcgagttc
      361 ctcttccacc cacttcacag catcgtgcct catccaattt caacactact cccagttcta
      421 ctaatctcta cattcgcggt ctcatgccaa acaccaacga tgatctcctt cgtgaaatgt
      481 gctccaagta cggaaacatt gcatcgacca aagctattat ggataaagca accaacaatt
      541 gcaagggata cggatttgtt gactttgaat ctccacaagc cgctgctgca gcagttgacg
      601 ggctcaacac tgaaggagtt caagcacaaa tggcaaagct tcaacaacaa gagcaagatc
      661 caaccaactt gtacattgcc aacttgccat tggacttcac cgaacaaatg ctcgagactg
      721 agctcaacaa gtttggaatg gtgatctcta cacgtattct tcgtactcca gacaatcagt
      781 cgcgtggagt cggattcgcc agaatggatt cgaaggaaaa gtgcgaagtt atcatttctg
      841 cgttgaatgg tggtcgcttc gatactatgt caaaggaagg tccagccctg ctcattaagc
      901 aagccgatac cggcaggaag agtaagctct ctgggcggac cgacggcgtt tttgaatggc
      961 cagcactcga tgaacaatcc tgaaatgctc cagcgaatgc aatatccaca agtctatcaa
     1021 tcgtactatg gataccatcc agctgcagtc taccaacaac actatgacgt taactcgttg
     1081 gcttcacaga tgggcggtat gcatgtcggt ggtggaaatc cacaggcgaa tggtggaggt
     1141 gacatgtatg gagcacatat gtacggacag aatgccggtg gacaaggtgg acaaggagtc
     1201 ggacaaggcg gacagggtgg gaatcaacag ttttacaacc cgaataatgg acgcaacaaa
     1261 a
//