Dbfetch

LOCUS       NM_001267973            2469 bp    mRNA    linear   INV 21-JAN-2020
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), mRNA.
ACCESSION   NM_001267973
VERSION     NM_001267973.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2469)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2469)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2469)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2469)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Sep 4, 2019 this sequence version replaced NM_001267973.1.
FEATURES             Location/Qualifiers
     source          1..2469
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..2469
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             102..1322
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2i"
                     /note="Product from WormBase gene class sup;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254902.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2i.1"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2i.2"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCQ3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCQ3"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRV
                     QNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSVSSRRVPLPPTSQHRASSNFNT
                     TPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQA
                     AAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTR
                     ILRTPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGRKSKV
                     GSTSRHPSFQQFSSLGGPTAFLNGQHSMNNPEMLQRMQYPQVYQSYYGYHPAAVYQQH
                     YDVNSLASQMGGMHVGGGNPQANGGGDMYGAHMYGQNAGGQGGQGVGQGGQGGNQQFY
                     NPNNGRNKKPMNPQ"
ORIGIN      
        1 agcacattgc tttcgaacgg cccatctacc gtcttcactt aaccatctac tctcttaata
       61 accaacccaa agatcaataa aactatcaag aaccaagaag aatgaacgca tcttcggctc
      121 cacaacaaca acagcaacaa cagcagccac aacaagggca agctccccag caacaacaac
      181 agggaccacc acaacatcaa tatcaacaac aacgcccatt ccatggacgt gtccaaaacc
      241 atatgagagg aagcggaccg tttggaaaca gcaacggcta tggtcgttac acagctccac
      301 gtggtgacca gcagcatcac gactcgactc ctttgagctc ggtgagttcg cgtcgagttc
      361 ctcttccacc cacttcacag catcgtgcct catccaattt caacactact cccagttcta
      421 ctaatctcta cattcgcggt ctcatgccaa acaccaacga tgatctcctt cgtgaaatgt
      481 gctccaagta cggaaacatt gcatcgacca aagctattat ggataaagca accaacaatt
      541 gcaagggata cggatttgtt gactttgaat ctccacaagc cgctgctgca gcagttgacg
      601 ggctcaacac tgaaggagtt caagcacaaa tggcaaagct tcaacaacaa gagcaagatc
      661 caaccaactt gtacattgcc aacttgccat tggacttcac cgaacaaatg ctcgagactg
      721 agctcaacaa gtttggaatg gtgatctcta cacgtattct tcgtactcca gacaatcagt
      781 cgcgtggagt cggattcgcc agaatggatt cgaaggaaaa gtgcgaagtt atcatttctg
      841 cgttgaatgg tggtcgcttc gatactatgt caaaggaagg tccagccctg ctcattaagc
      901 aagccgatac cggcaggaag agtaaggttg gtagtacatc acgccacccc tcatttcaac
      961 agtttagctc tctgggcgga ccgacggcgt ttttgaatgg ccagcactcg atgaacaatc
     1021 ctgaaatgct ccagcgaatg caatatccac aagtctatca atcgtactat ggataccatc
     1081 cagctgcagt ctaccaacaa cactatgacg ttaactcgtt ggcttcacag atgggcggta
     1141 tgcatgtcgg tggtggaaat ccacaggcga atggtggagg tgacatgtat ggagcacata
     1201 tgtacggaca gaatgccggt ggacaaggtg gacaaggagt cggacaaggc ggacagggtg
     1261 ggaatcaaca gttttacaac ccgaataatg gacgcaacaa aaagccgatg aatccacaat
     1321 aaatggacag gacaacgtct tcactccact tcttctttcg tctctaaacc tcttctctct
     1381 ctcaatcctt tccaaccaat catctctaca aaaaaagaca cagtgtgctg ccgcgcgcgc
     1441 cgcaatcaat acccatgttc atattgttag cccgctcccc gatccacaaa accttcttct
     1501 ttttctcaat ccaaaaacta tcgttccatt ctgaaaactc atcatcacca gtttaaaaat
     1561 tgttttgttt ttcttcccct cccgaaatct ctatacctct ccttttctac cacgttgtta
     1621 ggcgaacaat ctctcgaagc gaagatgatc atgttttttt aattaaaaaa tgatgatggg
     1681 tttgcaagag tctctctttt aaccgtttca tgaaacaaac tgaagacaca acaagcgaac
     1741 atacacactg gtttttcctt tttgtttatt gatttctttt aagttaacag cacatacact
     1801 ctgcgtctct ctctctctct ccctctctat ctctatggtc taactatcag atcagaacta
     1861 tttaaacctt atgaatcgat cacccccaga cacctctaat ttaaatgttt aaatgttctt
     1921 ttgactggtt tcaaatgctc atttcctccc ttcttttttc tcttttcctc ttgaaacgaa
     1981 catctcccca catgtacata gacccccccc cccaaaagtt tcttaaattg ttgtttgact
     2041 ggactcttag gaacctattc agacacatac tccatccctt acacctcttg ttgattgacc
     2101 tttgttttgt tttgttgttc ctgggtcttt tgaacccctc aataaccgcg aaacttttaa
     2161 gcttctcctc tctctctccc tcactcattc tcctttcctc gcccggtgac accgttccgt
     2221 catcgtcgag tacgtctaca gcagcagcag ctcgaagagc tccggaatcc gtgagctctc
     2281 tctctctttg ttctttctaa ccatttcaat ggcaatcaca ttctccccca ccaaccccct
     2341 gactttctct aaactgttcg ttcgttccca ccccaccact tctccacccc caaattgttt
     2401 ttctttccga aattcgtttt ccaacaaatt ctgatgagca agaatgatgt aaataaatga
     2461 ttccagaga
//