Dbfetch

LOCUS       NM_001267972            2396 bp    mRNA    linear   INV 21-JAN-2020
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), mRNA.
ACCESSION   NM_001267972
VERSION     NM_001267972.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2396)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2396)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2396)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2396)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Sep 4, 2019 this sequence version replaced NM_001267972.1.
FEATURES             Location/Qualifiers
     source          1..2396
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..2396
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             102..1244
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2g"
                     /note="Product from WormBase gene class sup;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254901.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2g.1"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2g.2"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCQ2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCQ2"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRV
                     QNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSVSSRRVPLPPTSQHRASSNFNT
                     TPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQA
                     AAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTR
                     ILRTPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGRKSKH
                     SMNNPEMLQRMQYPQVYQSYYGYHPAAVYQQHYDVNSLASQMGGMHVGGGNPQANGGG
                     DMYGAHMYGQNAGGQGGQGVGQGGQGGNQQFYNPNNGRNKKPMNPQ"
ORIGIN      
        1 agcacattgc tttcgaacgg cccatctacc gtcttcactt aaccatctac tctcttaata
       61 accaacccaa agatcaataa aactatcaag aaccaagaag aatgaacgca tcttcggctc
      121 cacaacaaca acagcaacaa cagcagccac aacaagggca agctccccag caacaacaac
      181 agggaccacc acaacatcaa tatcaacaac aacgcccatt ccatggacgt gtccaaaacc
      241 atatgagagg aagcggaccg tttggaaaca gcaacggcta tggtcgttac acagctccac
      301 gtggtgacca gcagcatcac gactcgactc ctttgagctc ggtgagttcg cgtcgagttc
      361 ctcttccacc cacttcacag catcgtgcct catccaattt caacactact cccagttcta
      421 ctaatctcta cattcgcggt ctcatgccaa acaccaacga tgatctcctt cgtgaaatgt
      481 gctccaagta cggaaacatt gcatcgacca aagctattat ggataaagca accaacaatt
      541 gcaagggata cggatttgtt gactttgaat ctccacaagc cgctgctgca gcagttgacg
      601 ggctcaacac tgaaggagtt caagcacaaa tggcaaagct tcaacaacaa gagcaagatc
      661 caaccaactt gtacattgcc aacttgccat tggacttcac cgaacaaatg ctcgagactg
      721 agctcaacaa gtttggaatg gtgatctcta cacgtattct tcgtactcca gacaatcagt
      781 cgcgtggagt cggattcgcc agaatggatt cgaaggaaaa gtgcgaagtt atcatttctg
      841 cgttgaatgg tggtcgcttc gatactatgt caaaggaagg tccagccctg ctcattaagc
      901 aagccgatac cggcaggaag agtaagcact cgatgaacaa tcctgaaatg ctccagcgaa
      961 tgcaatatcc acaagtctat caatcgtact atggatacca tccagctgca gtctaccaac
     1021 aacactatga cgttaactcg ttggcttcac agatgggcgg tatgcatgtc ggtggtggaa
     1081 atccacaggc gaatggtgga ggtgacatgt atggagcaca tatgtacgga cagaatgccg
     1141 gtggacaagg tggacaagga gtcggacaag gcggacaggg tgggaatcaa cagttttaca
     1201 acccgaataa tggacgcaac aaaaagccga tgaatccaca ataaatggac aggacaacgt
     1261 cttcactcca cttcttcttt cgtctctaaa cctcttctct ctctcaatcc tttccaacca
     1321 atcatctcta caaaaaaaga cacagtgtgc tgccgcgcgc gccgcaatca atacccatgt
     1381 tcatattgtt agcccgctcc ccgatccaca aaaccttctt ctttttctca atccaaaaac
     1441 tatcgttcca ttctgaaaac tcatcatcac cagtttaaaa attgttttgt ttttcttccc
     1501 ctcccgaaat ctctatacct ctccttttct accacgttgt taggcgaaca atctctcgaa
     1561 gcgaagatga tcatgttttt ttaattaaaa aatgatgatg ggtttgcaag agtctctctt
     1621 ttaaccgttt catgaaacaa actgaagaca caacaagcga acatacacac tggtttttcc
     1681 tttttgttta ttgatttctt ttaagttaac agcacataca ctctgcgtct ctctctctct
     1741 ctccctctct atctctatgg tctaactatc agatcagaac tatttaaacc ttatgaatcg
     1801 atcaccccca gacacctcta atttaaatgt ttaaatgttc ttttgactgg tttcaaatgc
     1861 tcatttcctc ccttcttttt tctcttttcc tcttgaaacg aacatctccc cacatgtaca
     1921 tagacccccc cccccaaaag tttcttaaat tgttgtttga ctggactctt aggaacctat
     1981 tcagacacat actccatccc ttacacctct tgttgattga cctttgtttt gttttgttgt
     2041 tcctgggtct tttgaacccc tcaataaccg cgaaactttt aagcttctcc tctctctctc
     2101 cctcactcat tctcctttcc tcgcccggtg acaccgttcc gtcatcgtcg agtacgtcta
     2161 cagcagcagc agctcgaaga gctccggaat ccgtgagctc tctctctctt tgttctttct
     2221 aaccatttca atggcaatca cattctcccc caccaacccc ctgactttct ctaaactgtt
     2281 cgttcgttcc caccccacca cttctccacc cccaaattgt ttttctttcc gaaattcgtt
     2341 ttccaacaaa ttctgatgag caagaatgat gtaaataaat gattccagag atttta
//