Dbfetch

LOCUS       NM_001267971            2331 bp    mRNA    linear   INV 27-MAY-2020
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), mRNA.
ACCESSION   NM_001267971
VERSION     NM_001267971.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2331)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2331)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAY-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2331)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (21-APR-2020) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2331)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On May 27, 2020 this sequence version replaced NM_001267971.3.
FEATURES             Location/Qualifiers
     source          1..2331
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..2331
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             109..1173
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2f"
                     /note="Product from WormBase gene class sup;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254900.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.1"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.2"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.3"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.4"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCQ1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCQ1"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRV
                     QNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSTNLYIRGLMPNTNDDLLREMCS
                     KYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQD
                     PTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQSRGVGFARMDSKEKCEVI
                     ISALNGGRFDTMSKEGPALLIKQADTGRKSKHSMNNPEMLQRMQYPQVYQSYYGYHPA
                     AVYQQHYDVNSLASQMGGMHVGGGNPQANGGGDMYGAHMYGQNAGGQGGQGVGQGGQG
                     GNQQFYNPNNGRNKKPMNPQ"
ORIGIN      
        1 gttacagagc acattgcttt cgaacggccc atctaccgtc ttcacttaac catctactct
       61 cttaataacc aacccaaaga tcaataaaac tatcaagaac caagaagaat gaacgcatct
      121 tcggctccac aacaacaaca gcaacaacag cagccacaac aagggcaagc tccccagcaa
      181 caacaacagg gaccaccaca acatcaatat caacaacaac gcccattcca tggacgtgtc
      241 caaaaccata tgagaggaag cggaccgttt ggaaacagca acggctatgg tcgttacaca
      301 gctccacgtg gtgaccagca gcatcacgac tcgactcctt tgagctcgac taatctctac
      361 attcgcggtc tcatgccaaa caccaacgat gatctccttc gtgaaatgtg ctccaagtac
      421 ggaaacattg catcgaccaa agctattatg gataaagcaa ccaacaattg caagggatac
      481 ggatttgttg actttgaatc tccacaagcc gctgctgcag cagttgacgg gctcaacact
      541 gaaggagttc aagcacaaat ggcaaagctt caacaacaag agcaagatcc aaccaacttg
      601 tacattgcca acttgccatt ggacttcacc gaacaaatgc tcgagactga gctcaacaag
      661 tttggaatgg tgatctctac acgtattctt cgtactccag acaatcagtc gcgtggagtc
      721 ggattcgcca gaatggattc gaaggaaaag tgcgaagtta tcatttctgc gttgaatggt
      781 ggtcgcttcg atactatgtc aaaggaaggt ccagccctgc tcattaagca agccgatacc
      841 ggcaggaaga gtaagcactc gatgaacaat cctgaaatgc tccagcgaat gcaatatcca
      901 caagtctatc aatcgtacta tggataccat ccagctgcag tctaccaaca acactatgac
      961 gttaactcgt tggcttcaca gatgggcggt atgcatgtcg gtggtggaaa tccacaggcg
     1021 aatggtggag gtgacatgta tggagcacat atgtacggac agaatgccgg tggacaaggt
     1081 ggacaaggag tcggacaagg cggacagggt gggaatcaac agttttacaa cccgaataat
     1141 ggacgcaaca aaaagccgat gaatccacaa taaatggaca ggacaacgtc ttcactccac
     1201 ttcttctttc gtctctaaac ctcttctctc tctcaatcct ttccaaccaa tcatctctac
     1261 aaaaaaagac acagtgtgct gccgcgcgcg ccgcaatcaa tacccatgtt catattgtta
     1321 gcccgctccc cgatccacaa aaccttcttc tttttctcaa tccaaaaact atcgttccat
     1381 tctgaaaact catcatcacc agtttaaaaa ttgttttgtt tttcttcccc tcccgaaatc
     1441 tctatacctc tccttttcta ccacgttgtt aggcgaacaa tctctcgaag cgaagatgat
     1501 catgtttttt taattaaaaa atgatgatgg gtttgcaaga gtctctcttt taaccgtttc
     1561 atgaaacaaa ctgaagacac aacaagcgaa catacacact ggtttttcct ttttgtttat
     1621 tgatttcttt taagttaaca gcacatacac tctgcgtctc tctctctctc tccctctcta
     1681 tctctatggt ctaactatca gatcagaact atttaaacct tatgaatcga tcacccccag
     1741 acacctctaa tttaaatgtt taaatgttct tttgactggt ttcaaatgct catttcctcc
     1801 cttctttttt ctcttttcct cttgaaacga acatctcccc acatgtacat agaccccccc
     1861 ccccaaaagt ttcttaaatt gttgtttgac tggactctta ggaacctatt cagacacata
     1921 ctccatccct tacacctctt gttgattgac ctttgttttg ttttgttgtt cctgggtctt
     1981 ttgaacccct caataaccgc gaaactttta agcttctcct ctctctctcc ctcactcatt
     2041 ctcctttcct cgcccggtga caccgttccg tcatcgtcga gtacgtctac agcagcagca
     2101 gctcgaagag ctccggaatc cgtgagctct ctctctcttt gttctttcta accatttcaa
     2161 tggcaatcac attctccccc accaaccccc tgactttctc taaactgttc gttcgttccc
     2221 accccaccac ttctccaccc ccaaattgtt tttctttccg aaattcgttt tccaacaaat
     2281 tctgatgagc aagaatgatg taaataaatg attccagaga ttttataatt c
//