Dbfetch

LOCUS       NM_001267966            2280 bp    mRNA    linear   INV 21-JAN-2020
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), mRNA.
ACCESSION   NM_001267966
VERSION     NM_001267966.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2280)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2280)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2280)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2280)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Sep 4, 2019 this sequence version replaced NM_001267966.1.
FEATURES             Location/Qualifiers
     source          1..2280
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            1..2280
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             102..1340
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2n"
                     /note="Product from WormBase gene class sup;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254895.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2n.1"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2n.2"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2n.3"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2n.4"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCQ7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCQ7"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRV
                     QNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSTNLYIRGLMPNTNDDLLREMCS
                     KYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQD
                     PTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQSRGVGFARMDSKEKCEVI
                     ISALNGGRFDTMSKEGPALLIKQADTGRKSKHSMNNPEMLQRMQYPQVYQSYYGYHPA
                     AVYQQHYDVNSLASQMGGMHVGGGNPQANGGGDMYGAHMYGQNAGGQGGQGVGQGGQV
                     FPADESTINGQDNVFTPLLLSSLNLFSLSILSNQSSLQKKTQCAAARAAINTHVHIVS
                     PLPDPQNLLLFLNPKTIVPF"
ORIGIN      
        1 agcacattgc tttcgaacgg cccatctacc gtcttcactt aaccatctac tctcttaata
       61 accaacccaa agatcaataa aactatcaag aaccaagaag aatgaacgca tcttcggctc
      121 cacaacaaca acagcaacaa cagcagccac aacaagggca agctccccag caacaacaac
      181 agggaccacc acaacatcaa tatcaacaac aacgcccatt ccatggacgt gtccaaaacc
      241 atatgagagg aagcggaccg tttggaaaca gcaacggcta tggtcgttac acagctccac
      301 gtggtgacca gcagcatcac gactcgactc ctttgagctc gactaatctc tacattcgcg
      361 gtctcatgcc aaacaccaac gatgatctcc ttcgtgaaat gtgctccaag tacggaaaca
      421 ttgcatcgac caaagctatt atggataaag caaccaacaa ttgcaaggga tacggatttg
      481 ttgactttga atctccacaa gccgctgctg cagcagttga cgggctcaac actgaaggag
      541 ttcaagcaca aatggcaaag cttcaacaac aagagcaaga tccaaccaac ttgtacattg
      601 ccaacttgcc attggacttc accgaacaaa tgctcgagac tgagctcaac aagtttggaa
      661 tggtgatctc tacacgtatt cttcgtactc cagacaatca gtcgcgtgga gtcggattcg
      721 ccagaatgga ttcgaaggaa aagtgcgaag ttatcatttc tgcgttgaat ggtggtcgct
      781 tcgatactat gtcaaaggaa ggtccagccc tgctcattaa gcaagccgat accggcagga
      841 agagtaagca ctcgatgaac aatcctgaaa tgctccagcg aatgcaatat ccacaagtct
      901 atcaatcgta ctatggatac catccagctg cagtctacca acaacactat gacgttaact
      961 cgttggcttc acagatgggc ggtatgcatg tcggtggtgg aaatccacag gcgaatggtg
     1021 gaggtgacat gtatggagca catatgtacg gacagaatgc cggtggacaa ggtggacaag
     1081 gagtcggaca aggcggacag gtatttccag ccgatgaatc cacaataaat ggacaggaca
     1141 acgtcttcac tccacttctt ctttcgtctc taaacctctt ctctctctca atcctttcca
     1201 accaatcatc tctacaaaaa aagacacagt gtgctgccgc gcgcgccgca atcaataccc
     1261 atgttcatat tgttagcccg ctccccgatc cacaaaacct tcttcttttt ctcaatccaa
     1321 aaactatcgt tccattctga aaactcatca tcaccagttt aaaaattgtt ttgtttttct
     1381 tcccctcccg aaatctctat acctctcctt ttctaccacg ttgttaggcg aacaatctct
     1441 cgaagcgaag atgatcatgt ttttttaatt aaaaaatgat gatgggtttg caagagtctc
     1501 tcttttaacc gtttcatgaa acaaactgaa gacacaacaa gcgaacatac acactggttt
     1561 ttcctttttg tttattgatt tcttttaagt taacagcaca tacactctgc gtctctctct
     1621 ctctctccct ctctatctct atggtctaac tatcagatca gaactattta aaccttatga
     1681 atcgatcacc cccagacacc tctaatttaa atgtttaaat gttcttttga ctggtttcaa
     1741 atgctcattt cctcccttct tttttctctt ttcctcttga aacgaacatc tccccacatg
     1801 tacatagacc ccccccccca aaagtttctt aaattgttgt ttgactggac tcttaggaac
     1861 ctattcagac acatactcca tcccttacac ctcttgttga ttgacctttg ttttgttttg
     1921 ttgttcctgg gtcttttgaa cccctcaata accgcgaaac ttttaagctt ctcctctctc
     1981 tctccctcac tcattctcct ttcctcgccc ggtgacaccg ttccgtcatc gtcgagtacg
     2041 tctacagcag cagcagctcg aagagctccg gaatccgtga gctctctctc tctttgttct
     2101 ttctaaccat ttcaatggca atcacattct cccccaccaa ccccctgact ttctctaaac
     2161 tgttcgttcg ttcccacccc accacttctc cacccccaaa ttgtttttct ttccgaaatt
     2221 cgttttccaa caaattctga tgagcaagaa tgatgtaaat aaatgattcc agagatttta
//