Dbfetch

LOCUS       NM_001267462             688 bp    mRNA    linear   INV 05-SEP-2019
DEFINITION  Caenorhabditis elegans Uncharacterized protein (E01G4.3), mRNA.
ACCESSION   NM_001267462
VERSION     NM_001267462.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 688)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 688)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 688)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 688)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Sep 4, 2019 this sequence version replaced NM_001267462.1.
FEATURES             Location/Qualifiers
     source          1..688
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            1..688
                     /gene="E01G4.3"
                     /locus_tag="CELE_E01G4.3"
                     /db_xref="GeneID:174988"
                     /db_xref="WormBase:WBGene00008446"
     CDS             89..481
                     /gene="E01G4.3"
                     /locus_tag="CELE_E01G4.3"
                     /standard_name="E01G4.3a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_001254391.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00008446"
                     /db_xref="EnsemblGenomes-Tr:E01G4.3a"
                     /db_xref="GeneID:174988"
                     /db_xref="UniProtKB/TrEMBL:O02237"
                     /db_xref="WormBase:WBGene00008446"
                     /translation="MLQQSNELSTAFIQLQSRLAAQKMPSTQAKQVLAHALIETLQNW
                     CMQLFWMTVLCVINCCAEEDEKKPKRKHQEHPEFKKRIEDIEQKMLRHLTSPMISGPL
                     RPVRKLSSRRVFSSRPPSPQLFDIAEEE"
ORIGIN      
        1 tctctcttat aatacacaca gcacgcccca gaccaccagc cgtcagcaat tcattcagtc
       61 attgacacat acacaagaca agcgaacgat gcttcaacag agtaacgaat tatcgactgc
      121 ttttattcag ctccaatcaa gacttgctgc tcagaagatg ccttcgacac aagcgaaaca
      181 agtgctcgct catgctctca tcgaaaccct ccaaaattgg tgcatgcagc tcttctggat
      241 gacagttctg tgcgttatca actgctgtgc cgaagaggac gagaaaaaac cgaagagaaa
      301 gcaccaagag catccagaat tcaagaagag aattgaggat attgagcaga agatgctccg
      361 ccacctcacc tcgccaatga tttcgggacc acttcgccca gtccgaaagc tcagctctcg
      421 acgtgttttc tcgtcaagac cgccaagccc acaactgttc gatattgccg aggaagagta
      481 gattccccct atcttcacac aaattgccac acacacaact aatcttttat cctttttccc
      541 gaccatttct cacattcttg atctgtttat atatacgagt agctcttcta aatcattacg
      601 tgtaaattga taggtgcccc acgagacccc tcatgtccat gtgtttgcat tcctcgaaac
      661 gaacgatgaa taaacgaatt cacaattt
//