Dbfetch

LOCUS       NM_001129535             821 bp    mRNA    linear   INV 05-SEP-2019
DEFINITION  Caenorhabditis elegans Uncharacterized protein (mec-1), partial
            mRNA.
ACCESSION   NM_001129535
VERSION     NM_001129535.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 821)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 821)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 821)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 821)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Sep 4, 2019 this sequence version replaced NM_001129535.3.
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..821
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            1..>821
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /db_xref="GeneID:188259"
                     /db_xref="WormBase:WBGene00003165"
     CDS             54..821
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /standard_name="T07H8.4j"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_001123007.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003165"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4j.1"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4j.2"
                     /db_xref="GeneID:188259"
                     /db_xref="GOA:A5A8R2"
                     /db_xref="InterPro:IPR000152"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR001881"
                     /db_xref="InterPro:IPR002223"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR018097"
                     /db_xref="InterPro:IPR020901"
                     /db_xref="InterPro:IPR036880"
                     /db_xref="UniProtKB/TrEMBL:A5A8R2"
                     /db_xref="WormBase:WBGene00003165"
                     /translation="MHLFLLFIPHVIAVKDLAWYSANPVLSSSHPVGPAAIQAATAID
                     FCQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRCVKQPNK
                     PEVQELKHRRTVTSTTSTPFQTVNEESTVEPSATKRLPVTLPVKKLELVQSGHGNGLC
                     QDCDPLYGTCLDGKCGCMKGFRSLGKVCIDLNECDNGAVCGPNARCVNEIGSFQCVCD
                     AGFSTDGDCKIGQEACMDEFDVNLTEEDCNNGKQEIK"
ORIGIN      
        1 atacatcaaa ttgtccatct aatggaagtt tactagatta actaaatcaa atgatgcact
       61 tgtttctttt attcatacca catgttatag ccgttaagga tcttgcttgg tattctgcaa
      121 atccggtgct gagctcatca catccagtag gcccagctgc tatacaagca gcgacagcca
      181 tcgacttctg tcagctacca gtcgacactg gaaagtgttc tcaacaactt gtgcgctatt
      241 attatgacgc ggcagtcgat gaatgcaagc gattcacttt ttcaggttgt ggaggtaatt
      301 caaataggtt tatgagaagg gcgcattgtc ggaacagatg tgtgaagcag cccaataaac
      361 ctgaggttca agaactgaaa catagaagga cagtgacttc gacgacatcg acaccatttc
      421 aaacagttaa cgaggaaagt acagttgaac cgtcagcaac aaaacgattg cctgtgacgt
      481 tacctgtgaa aaaattggaa cttgttcagt cgggtcatgg aaatggtttg tgccaagatt
      541 gcgatccact ctatggaact tgcttagacg gaaaatgtgg atgtatgaaa ggcttccgat
      601 ctcttggaaa agtctgtatt gatctcaatg aatgtgataa tggagcggtt tgtggtccga
      661 atgcccgatg cgtgaacgaa attgggtcat ttcaatgtgt ttgtgacgct gggtttagta
      721 ccgatgggga ttgtaaaatc gggcaagagg catgtatgga tgaatttgat gtgaatttaa
      781 ctgaagaaga ttgcaacaat gggaaacagg aaatcaagtg a
//