Dbfetch

LOCUS       NM_001129178            4308 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Protein patched homolog 3 (ptc-3), partial
            mRNA.
ACCESSION   NM_001129178
VERSION     NM_001129178.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4308)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4308)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4308)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4308)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Sep 4, 2019 this sequence version replaced NM_001129178.1.
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..4308
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..4308
                     /gene="ptc-3"
                     /locus_tag="CELE_Y110A2AL.8"
                     /db_xref="GeneID:173631"
                     /db_xref="WormBase:WBGene00004210"
     CDS             1..4104
                     /gene="ptc-3"
                     /locus_tag="CELE_Y110A2AL.8"
                     /standard_name="Y110A2AL.8c"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Protein patched homolog 3"
                     /protein_id="NP_001122650.1"
                     /db_xref="EnsemblGenomes-Tr:Y110A2AL.8c"
                     /db_xref="GeneID:173631"
                     /db_xref="GOA:H2L0G5"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/Swiss-Prot:H2L0G5"
                     /db_xref="WormBase:WBGene00004210"
                     /translation="MSFPDEETDLLSEAKHCIRNVIHRTHRKFLENRLIGNFDSEDFS
                     DAWKKKFAHAPTWCDADMSLQQIKRGKAVGNTVALTARAFFQLWLFRIGCFVQRWAWS
                     TIFISLFLYCLCLGGLRHVTIETDLVKLWVSEGGRLNEEMGYLGQVKFERESGHLVHK
                     VKRAVEQTTEPPAPAVKAEVRRGPELPKENGLGGGFQVVIQTPSFDGQNILSKEALQQ
                     HTKLMEEISTYEVKMFNETWTLSDICFKPPGPSFNSGPLAGIMSKLLDKIIPCIWITP
                     IDCYWDGAKPLGPNPPLNLGPEVASFVSSLPPGNVTWKNLNPTSVIKEVGTLFDLGPI
                     GNFFERAGIDGAYLDRPCIDPLEEECPKSAPNYFDRCHALTKFNEWNMAKAMSEQVTL
                     ERKIIPKDDGKSDIAETILNDIFGKKRRKRQADTTTKKPATKKDEDYYEYEDDADYLA
                     GIANSTIAKKNPEKEAKDLLCLEYGSSLLKWMQENPERLGEFLTKEEMPDYPNYGDVM
                     TGGCKGFGKKIMEWPEDLIIGGIQRDNGKLVSAEALQSVFLVSGAYDVFARIKNDKTD
                     SHPGLDRHHFQPWMAGEIISTWQRNFTKRLYSHELNRERRQFHPLASTSIADMLEEFS
                     QFNYIIIVIGYILMVIYAAFTQGRFQGWWLAVQSNVALAICGVILVTISSICGLGFAT
                     HLGINFNAATTQVVPFLSLGLGIDDMFLLLHNYDEIINICNKNEIGVLLKETGMSVML
                     TSINNILAFISGYVLPIPALRSFCSQTAILLAFNLIFLMFIFPAMIGIDLRRQRKGKR
                     DLAYCSRGNPQMATSQSVPSNVSNMSSRAELAGYEKQADEYKRHEPWYTVGGFLNKIY
                     IPALKNNVVKACVLIGTTTAVVFGLYGMYTSTLGLELADVLPEHTPPAAFLRAREQYF
                     SFYPMFAVLRGDKLDIPNQQQLIEEYRAQLGSSKFMIKAEGKLQPYWMSMLRVWLQSL
                     DMALEKDLAAGKFDLTNGNPIKVNGEKPSPESMIAARLVCSFGTNYNCDGRLGKMKMV
                     ENEVINPEGFYNYLTGWFNVDNMMYYVSQASFYPTPPGWEYNEKLAKVVPAAEPLLYS
                     QMPFYQNDLIDTPAIVKMIEEIRATCEEYSERGLSNHPSGIAFTFWEQYLTLRWNLFQ
                     AICIIALAVFCVISILMFNPWAATLIMCIVVITTIELGGFMGLMGIKMNPISAVTLIC
                     AVGIGVEFTAHVELAFLTALGTIDQRLESCLQHMFVPVYHGAISTFLGVVMLVFSEFD
                     FVVTYFFYTMTLLVALGVFNGLCVLPVILTLVGPKPELTPTDGSSVLPPPPPLRQQYA
                     EKSGGVEGGMRKRKEKRPAEVEMSARDSPSTSSASHSSDDESSPAHK"
ORIGIN      
        1 atgtcgtttc ctgatgagga aactgattta ttatcagaag ctaaacattg tattcggaat
       61 gttattcatc gtactcatag gaagtttctg gaaaaccgcc tgatcggaaa tttcgattcc
      121 gaagatttct cagatgcgtg gaagaaaaaa ttcgcccacg cgccgacttg gtgtgatgca
      181 gacatgtctc ttcagcagat taagcggggt aaagccgttg gaaacaccgt tgcgctcacc
      241 gccagagcat ttttccaatt atggttgttc aggataggat gttttgtgca acgatgggct
      301 tggtccacta tttttatcag tttattcctc tactgcctct gcctcggagg ccttcgccac
      361 gtcacaatcg aaaccgatct cgtgaaactt tgggtgtcag aaggtggacg gctgaatgaa
      421 gaaatgggat atctcggcca agttaaattt gaacgagaat ccggacacct agtgcataaa
      481 gtgaaaagag ccgtcgaaca gactacggag ccgccggcac cggcagtgaa ggcagaagtc
      541 cggcgtggtc ccgagctgcc aaaggaaaac ggattgggag gaggttttca ggtggtaatc
      601 caaactccgt ccttcgatgg tcagaatatt ctctccaagg aggctctgca gcagcatacc
      661 aagttgatgg aggaaatttc tacgtatgaa gtgaaaatgt tcaatgaaac ctggaccctc
      721 tccgacatct gcttcaagcc gccaggccca tctttcaaca gtggcccgct ggctggaatc
      781 atgtccaagc tccttgacaa gatcattcca tgcatctgga tcacaccgat cgattgctat
      841 tgggatggtg caaagccact gggaccaaat cctccgttga acttgggccc agaagtcgcc
      901 agcttcgtgt cctccctccc acctggcaac gttacctgga agaacttgaa tccaacatct
      961 gtcatcaaag aggtcggcac cctattcgac ttgggaccca tcggcaactt tttcgaaaga
     1021 gccggtattg acggagccta cctcgacagg ccatgcattg acccactgga ggaggaatgc
     1081 ccaaagtctg ctccgaacta cttcgatagg tgtcatgcac tgacaaagtt taacgagtgg
     1141 aatatggcaa aggccatgag cgagcaggtc accctggagc gcaaaataat cccaaaggac
     1201 gatggaaagt cagacatcgc cgaaacgatt ctcaacgaca tttttggaaa gaagagaagg
     1261 aagcgacaag cggatactac gaccaagaag cctgccacga aaaaagacga agactactac
     1321 gagtacgaag acgacgcgga ctacctagca ggaatcgcca actccacaat cgccaagaag
     1381 aatccggaaa aggaagccaa ggaccttctg tgccttgagt acggaagctc acttctcaag
     1441 tggatgcagg agaatcccga gagactcggc gagttcttga ccaaggagga gatgccagat
     1501 tacccgaact atggagatgt gatgaccggt ggatgtaagg gattcggaaa gaagatcatg
     1561 gagtggccgg aggacttgat cattggagga atccagcggg acaatgggaa gttggtgtca
     1621 gcagaggccc tgcaatccgt gttcctggtc tcaggagcct atgacgtgtt tgccagaatc
     1681 aagaacgaca aaaccgacag ccaccccggc cttgaccgcc accacttcca accatggatg
     1741 gctggagaga tcatcagcac gtggcagaga aacttcacca agcgactcta cagccatgag
     1801 ctcaaccgtg aacgccgtca gttccacccc ctagcttcca cctcaatcgc tgacatgctc
     1861 gaggagttct cccagttcaa ctacatcatc atcgtcatcg gatacatctt gatggtgatc
     1921 tacgccgcgt ttacccaggg aaggttccaa ggatggtggc tggctgtgca gtcaaatgtg
     1981 gcattggcaa tttgcggagt tatcctggtt actatatcat cgatttgtgg attaggattc
     2041 gctactcatc ttgggatcaa tttcaatgca gcgacaactc aagttgtgcc attcctttcc
     2101 ttaggtctag gaatcgatga tatgttcctc cttctgcata actacgatga aatcatcaat
     2161 atttgcaaca aaaacgagat cggagtattg ctaaaagaga ccggaatgtc tgtgatgttg
     2221 acctctatca acaacattct cgccttcatc tcgggatacg ttctcccgat ccctgctcta
     2281 cgatccttct gctcccaaac cgcgattctc cttgccttca acttgatctt cctcatgttc
     2341 atcttcccag caatgatcgg aatcgatctg agaagacagc gaaaaggaaa aagagatttg
     2401 gcctactgca gtcgaggaaa cccacaaatg gcgactagtc aaagtgtgcc gagcaatgtt
     2461 tcaaatatgt catcacgtgc cgagttggct ggctacgaga agcaggccga cgagtataag
     2521 cgtcacgagc cgtggtacac cgtcggagga ttcctcaaca agatctacat tccggcactc
     2581 aagaataatg ttgttaaggc ttgcgttctc atcggaacta ccaccgccgt cgtcttcgga
     2641 ctctacggaa tgtacacctc gactctcggt ctcgagctcg ccgacgtgct tccagagcac
     2701 accccaccag cggccttcct tcgtgctcgc gagcaatact tctccttcta cccgatgttt
     2761 gcagttcttc gtggtgacaa gcttgacatt ccgaaccaac agcaacttat cgaagagtac
     2821 agagcacagt tgggatcttc aaagtttatg atcaaggctg aaggtaaact tcaaccctac
     2881 tggatgtcta tgctcagagt ctggctgcaa tctttggaca tggccttgga aaaagacctc
     2941 gccgctggca aattcgattt gacaaatgga aatcctatca aggtgaacgg agagaagcca
     3001 agtcccgaat cgatgatcgc ggctagactt gtatgctcct tcggcaccaa ctacaactgt
     3061 gacgggcggc tcggaaagat gaagatggtg gaaaatgagg ttattaatcc agaaggattc
     3121 tataactatc tgacgggatg gttcaacgtt gacaacatga tgtactacgt gtcccaggct
     3181 tcattctatc caacaccacc tggatgggag tataatgaga agctcgccaa ggtggttccg
     3241 gctgccgagc cattgttgta ctcacagatg ccgttttatc agaatgattt gatcgataca
     3301 ccagcgattg taaaaatgat tgaggaaatc cgtgccactt gcgaggaata ctccgaacga
     3361 ggcctttcca accatccatc gggtatcgcc ttcaccttct gggagcaata tcttactttg
     3421 agatggaact tgttccaagc catctgcatc atcgcgctcg ccgtgttctg tgtcatttca
     3481 attctaatgt tcaatccatg ggcagccact cttatcatgt gcatcgtagt gatcactacc
     3541 atcgagctgg gaggattcat ggggcttatg ggcatcaaga tgaacccgat ttccgctgta
     3601 accctcatct gtgccgtcgg aatcggtgtc gagttcactg ctcacgtcga gttggccttc
     3661 ctgacagctc taggaaccat cgatcaacgc ctggagtctt gcctccagca catgttcgtg
     3721 ccagtctatc acggagccat ctcaacgttc ctcggagttg tgatgcttgt gttctccgag
     3781 ttcgacttcg tcgtcaccta cttcttctac acaatgacgt tgctggtagc gttgggtgtg
     3841 ttcaacgggt tgtgtgttct tccagtgatc cttacgctgg tcggcccgaa gcctgagctg
     3901 acaccaaccg atggtagcag tgtgcttcca ccacctccac cattgcggca gcagtacgct
     3961 gagaagagtg gaggtgtgga aggtgggatg aggaaacgga aggagaagag gcctgcggag
     4021 gtcgaaatgt cggctcgcga ctctccatca acatcctcag cgtcccattc ttctgatgac
     4081 gagtcatcgc cagcgcacaa gtaataaaac aatacaatgt tatcccaatt tttccttttt
     4141 tcttgccaaa cgggtcaccg ttccccccac caattgtttt tttttgtttt ttgtcccttt
     4201 ttcgaaaaag tttctcggta gattttgacc caattcttgc atatctgtac tatatggttt
     4261 ttgttttcac cacacttttt ttctaaaatt aaagaattct aaaatctc
//