Dbfetch

LOCUS       NM_001047317            1417 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans L-glutamate gamma-semialdehyde dehydrogenase
            (alh-6), partial mRNA.
ACCESSION   NM_001047317
VERSION     NM_001047317.5
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1417)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1417)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1417)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1417)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Sep 4, 2019 this sequence version replaced NM_001047317.4.
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..1417
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..1417
                     /gene="alh-6"
                     /locus_tag="CELE_F56D12.1"
                     /db_xref="GeneID:173510"
                     /db_xref="WormBase:WBGene00000112"
     CDS             1..1272
                     /gene="alh-6"
                     /locus_tag="CELE_F56D12.1"
                     /standard_name="F56D12.1d"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="L-glutamate gamma-semialdehyde dehydrogenase"
                     /protein_id="NP_001040782.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00000112"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1d.1"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1d.2"
                     /db_xref="GeneID:173510"
                     /db_xref="GOA:G4RZC3"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:G4RZC3"
                     /db_xref="WormBase:WBGene00000112"
                     /translation="MKLNASTMLGQGKNIIQAEIDAACELIDFFRFNAVFAMELEHYE
                     PISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSN
                     YIIYELLEEAGMPPGILSFLPSDGPVFGDVITASPHLSAVNFTGSVPTFKTIWRKVAE
                     NLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAAGTARSAWEYSGQKCSACSRMYAPK
                     SIWPKILEKISAIHKEIKLGDVRDGSVFLSAVIDDKAFARLKAYIDFAKTGADGANVV
                     LGGKCDDKTGYFIEPTLITVTDPKSKLLTEEMFGPVVTVLVYEDSKVDEVLATVKDAT
                     PYGLTGAVFSQDKEFLYRARDVLRDAVGNMYLNDKSTGSIVGQQPFGGSRLSGTNDKA
                     GGPHYGLRWTSPLTIKETSVSLTDWKYPSME"
ORIGIN      
        1 atgaagctga acgcctccac gatgctcggc cagggaaaga atattattca ggctgaaatt
       61 gacgccgcct gtgagctcat cgatttcttc cgattcaacg cggttttcgc tatggagctg
      121 gagcattatg agccgatttc cacgaaaatc accaaaaata cgatgcagtt ccgtggaatg
      181 gagggattcg tcgccgcaat cgcaccgttc aattttacgg cgatcggagg aaatttgccg
      241 actgctccgg cgcttatggg taacgtctcc ctctggaagc catcgaacac cgccgtgctc
      301 tccaattata taatctacga actcctcgag gaagctggta tgccacctgg aattctctca
      361 ttcttgccat cagatggccc cgttttcggt gacgtcatca ccgcatctcc acacttgagc
      421 gctgtcaatt tcactggctc cgtgccaact ttcaagacga tttggagaaa agtcgccgag
      481 aatttggata actatgtgac ttttccgaaa ctcatcggag aatgcggcgg aaaaaacttc
      541 cactttgtgc atccatccgc ccacgtggac gctgtcgccg ctggaaccgc ccgttccgcc
      601 tgggaatatt cgggacaaaa gtgctcggcg tgctccagga tgtacgcgcc aaaatcgatt
      661 tggccaaaga ttctcgagaa aatctcggcg attcacaaag agatcaagct tggagatgtt
      721 cgcgatggat ccgtctttct gtcggctgtg atcgatgata aggcgtttgc caggctcaag
      781 gcctacattg actttgcgaa aaccggagcc gacggagcaa atgtggtgct cggcggaaaa
      841 tgtgacgaca aaacgggata cttcatcgag ccgaccctga tcactgtgac ggatccgaag
      901 agcaagcttc tcactgagga aatgttcgga ccggtggtga cggtactggt ctacgaggat
      961 tcgaaggttg atgaggtgct cgcgactgtg aaagacgcga caccttatgg gctgactggc
     1021 gccgtttttt cgcaggataa ggagttcctt tatagagctc gcgatgttct ccgcgacgcc
     1081 gtcggcaaca tgtacctcaa cgacaaatca actggatcaa tcgtcggcca gcagccattc
     1141 ggaggctcca gattgtccgg aaccaatgat aaggccggtg gcccccacta tgggctccga
     1201 tggacctcgc cgctgacgat taaggagacg tcggtgtcat tgactgactg gaaatatcca
     1261 tcaatggaat aattatgttg tttttttctt ttcatttccg atttttctca tattgagaat
     1321 atagttttct ttttgattag gtcaacaatt attgctttac cactgaattt taattttttt
     1381 tcccccgtga tcgcataata aattttgttt tttttcc
//