Dbfetch

LOCUS       NM_001029526            1588 bp    mRNA    linear   INV 05-SEP-2019
DEFINITION  Caenorhabditis elegans Uncharacterized protein (lsy-2), mRNA.
ACCESSION   NM_001029526
VERSION     NM_001029526.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1588)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1588)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1588)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1588)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            On Sep 4, 2019 this sequence version replaced NM_001029526.2.
FEATURES             Location/Qualifiers
     source          1..1588
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            1..1588
                     /gene="lsy-2"
                     /locus_tag="CELE_F49H12.1"
                     /db_xref="GeneID:180522"
                     /db_xref="WormBase:WBGene00003087"
     CDS             52..1071
                     /gene="lsy-2"
                     /locus_tag="CELE_F49H12.1"
                     /standard_name="F49H12.1b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_001024697.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003087"
                     /db_xref="EnsemblGenomes-Tr:F49H12.1a"
                     /db_xref="EnsemblGenomes-Tr:F49H12.1b.1"
                     /db_xref="EnsemblGenomes-Tr:F49H12.1b.2"
                     /db_xref="GeneID:180522"
                     /db_xref="GOA:Q4ZG90"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="UniProtKB/TrEMBL:Q4ZG90"
                     /db_xref="WormBase:WBGene00003087"
                     /translation="MTHGSNQSVYHHNQHMDDSEMMMDEQDYSQYQMGFPEEDEMVEG
                     MMTPRAVHQCNVCNKIFVSYKGLQQHAVIHTDQKPFRCDICSKSFRFKSNLFEHRSVH
                     TGFTPHACPYCGKTCRLKGNLKKHLRTHVTTKEELEAAWRPFASNRRPPADIPDDAIV
                     LRGAGGPYYTPPPRPKKKKLGLGEPEHWVDKLRRGDLLPQVELEDKIRRLEDTIFNNM
                     SLERWGNLFEIAKSIAFETHDCPVCKSQFMTRMDCVSHHTLEHENHREGLEFFCEKCY
                     RPFADEASYNQHMSYHTRVSSLIETGEIVPQPADPEILVPTNDEFQMLFGANFGQQMM
                     EPQLI"
ORIGIN      
        1 agtcaacgga attctgcgga tcagtccctc tctgaattca acagttccag tatgactcac
       61 gggtcgaatc agtcagttta tcaccacaat caacacatgg atgactccga aatgatgatg
      121 gatgagcagg attattctca gtatcaaatg gggtttcctg aagaagatga gatggtggaa
      181 ggaatgatga cccctcgagc tgtgcaccag tgtaatgttt gcaacaaaat atttgtttcc
      241 tataaaggtc tccagcagca tgcagtgata cacacagatc agaagccttt ccgatgtgat
      301 atttgttcaa aatcatttag gtttaagtcg aacttgtttg agcatcgttc agtccatacc
      361 ggcttcactc ctcacgcctg tccatattgt ggaaaaactt gtcgactgaa aggcaacctc
      421 aagaagcatc ttcgcacaca cgtcacgacg aaggaagagc tggaagctgc ctggaggccg
      481 tttgccagca accgtcggcc gcctgctgac atccctgacg acgccatcgt acttcgtgga
      541 gccggaggac cgtactacac gccgccgcct cgtccgaaga agaagaagct tggactcgga
      601 gaaccagagc actgggtgga caagttgaga agaggagatc ttctgccaca agttgagctt
      661 gaggacaaga tcagacgtct cgaagacact atcttcaaca acatgtctct tgagcgttgg
      721 ggcaaccttt tcgagattgc aaagtccatt gcattcgaga cccatgattg tccagtgtgc
      781 aagtctcaat tcatgaccag aatggattgt gtcagccatc acacactcga acacgaaaat
      841 catcgggagg gtcttgaatt tttctgcgaa aaatgctata gaccatttgc tgacgaggcc
      901 agctacaatc agcacatgag ctaccacacg cgagttagca gtttgattga aactggagaa
      961 attgttcctc agccagcaga tccggaaatt ttggtaccaa cgaatgacga gtttcaaatg
     1021 ctgtttggcg caaactttgg ccagcagatg atggaaccac agttgatttg aaattgatta
     1081 ttattattgt tgcttagata gagtaattca gcttgcgcac ttacccattt ttgacgcctt
     1141 cgatgacatt tctttcaact tctcttattc acctttttca aaacggggta cttttttctt
     1201 cttgtttttt tggttctttt cttacctcgg ggattagtat tttttgaaga tttcctaccc
     1261 attgacagac agacttgctc tttcaatcat ttttttttcc aaaattgtaa gcatgccgtt
     1321 tatcattgtt ggcattgatc tacaccagcg atatcttgct ccttatttcc atttgtaatc
     1381 cgttgttttt tattattata acctaatgta taacctattg aggagtttgt atagtcgttg
     1441 tagtagtctt tgtttgtttt accttttttt cccgttgcct gatttcgtct atttttatat
     1501 attcttctct tttgagccga ttgtataggt gttcgattaa tatgaagtgt cataattcaa
     1561 tttatggagt gaataataaa attttgat
//