Dbfetch

LOCUS       NM_001028948            5457 bp    mRNA    linear   INV 10-APR-2019
DEFINITION  Caenorhabditis elegans Uncharacterized protein (mec-1), partial
            mRNA.
ACCESSION   NM_001028948
VERSION     NM_001028948.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5457)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5457)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5457)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5457)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Jun 26, 2012 this sequence version replaced NM_001028948.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5457
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>5457
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /db_xref="GeneID:188259"
                     /db_xref="WormBase:WBGene00003165"
     CDS             1..5457
                     /gene="mec-1"
                     /locus_tag="CELE_T07H8.4"
                     /standard_name="T07H8.4f"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_001024119.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003165"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4a.1"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4a.2"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4d.1"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4d.2"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4f.1"
                     /db_xref="EnsemblGenomes-Tr:T07H8.4f.2"
                     /db_xref="GeneID:188259"
                     /db_xref="GOA:Q5ZR36"
                     /db_xref="InterPro:IPR000152"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR001881"
                     /db_xref="InterPro:IPR002223"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR018097"
                     /db_xref="InterPro:IPR020901"
                     /db_xref="InterPro:IPR036880"
                     /db_xref="UniProtKB/TrEMBL:Q5ZR36"
                     /db_xref="WormBase:WBGene00003165"
                     /translation="MKGFRSLGKVCIDLNECDNGAVCGPNARCVNEIGSFQCVCDAGF
                     STDGDCKIGQEACMDEFDVNLTEEDCNNGKQEIKYYYDADSVQCKQFFYGGCKTTSRN
                     FFADLQTCDVICVSNQRDYLKSKGQSLSHHPVLEISSDLNNGNDLKSNHYKIDLFSSP
                     SSPVTPNRPLSADDWPLKPITLKPALNLDFSQGKTKSTAEKHKEADDAEILVHQLTPE
                     HNSCDLKFEPVLREECISADWAEKFFWNSEFKDCEPFWYDSSCDPRDRAGKNFFETFE
                     DCKNKCDGVQSQYVVPITTVPDEQSKIEEVETSETPGIVDETTTTAAPEEESEENGFF
                     FKVKPQNYLEDVLSSETEETQHYGFNPNEFLKQNSQNQKPTEITEILRILPAQTEHDE
                     ASELKKEDKIEHDILEHLKNKEPTEKVLSTPSTCDLEYDDALRNECTSADWTELYYWN
                     AQFKECEAFWYDSSCGDQDFSKKNLFKNFDDCNNQCVKKIGEALKKMDPETTTTTSTT
                     TTTTTAPTTTKMEEPKRSNYKQSDPLNLILNKALNPDESSELPEKFPPAHEQGFVNFA
                     IKSEVTATTKFDRLKYMAEFRKKLLALPDNFSTTPKQSSPTSSPTTTRMRSPSTHKST
                     VSQATKTASSTPQSPSTTTSFDDFVEKEKKTVLETIKILDRPEDLCDEPLHPKLEEDC
                     KNDQWEIQWFFNSDRGACKSFWYGGCEIESRNFFPDHANCRHSCAHKYATPASFSSKV
                     YIPPGELSTPVPPRKDRLTTSLKLTYPHSEDLFPSEEHSTVVELDGNFQRTEKQERIR
                     LFPTKTFRPRAPTPTASNIVNVSEGEKTETAPAFYSHIDRVVHDMKTGEHPGYTKPEE
                     FVRRIESASNDYIKYDLQKPDVVTIIDKSPPTVPSRKERTERTEVTTKLPSTRSINDP
                     CDDEYDPKWDEDCLGDTWVVRSYYDSKAEKCKAFWYGGCHTSSRNIWFDKETCRTSCA
                     HKFPTDMPMYGGAQSSEVSAEILPSPQEENSSKETSSSSSSSSSSNTAHISPEHRFKV
                     DLDQKFADVKREHEGREDLAYSQMVQHPVTVSADCLEVYNASLSKPCGDGKSWSNRYF
                     YDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAGKSCLDKFDERYLEDC
                     RHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDLCESPPRELTQACLQP
                     FDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIFSTLEACQWICERKRD
                     ERKPAICADKFDTKYTESCGDSQWTEKWYFDQSSGDCSSFWWDECTSSSQNIFPDEKS
                     CTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGC
                     GGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRN
                     YGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTRASSEVCFEPPGDRGI
                     CGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRFATQDICENTCNGLMNSNDPRICS
                     FSPDWGSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRFDTFEICQKACEVTGTDPCM
                     ESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNFLTKEECQTKCEKRFPRAA
                     PSKKKAKVKLPVGYSGAKPKDKTPMLRHINLNGNNQTYFKSEPQWMDYSSCYGYRYNV
                     TGRDTILNVHYCAIRGSADCISESYRSTEGEEYCNILRPFLRGQNLYSFYFGLDSVNP
                     MYRPKDGLSGRIQRKNETIAAVLVLKANQCHEIC"
ORIGIN      
        1 atgaaaggct tccgatctct tggaaaagtc tgtattgatc tcaatgaatg tgataatgga
       61 gcggtttgtg gtccgaatgc ccgatgcgtg aacgaaattg ggtcatttca atgtgtttgt
      121 gacgctgggt ttagtaccga tggggattgt aaaatcgggc aagaggcatg tatggatgaa
      181 tttgatgtga atttaactga agaagattgc aacaatggga aacaggaaat caaatattac
      241 tatgatgctg atagtgttca atgcaaacaa tttttctatg gtggatgcaa gacaacttcg
      301 agaaattttt ttgcggattt acagacttgt gatgttattt gtgtgtccaa tcaaagagac
      361 tatttaaagt caaaaggtca atctctctcg caccatccag ttctcgaaat ttcatctgat
      421 ctcaataatg gaaacgattt gaaaagtaat cattacaaaa ttgatttatt ctcgtcacct
      481 tcgtcaccag tgacaccaaa ccgcccgtta tcagctgatg actggccgct gaaaccgatt
      541 acattgaagc cagcactgaa tcttgacttt tcacaaggaa agacaaaatc aacagctgaa
      601 aaacacaaag aagcagatga tgcggaaatc ttggtacatc agttgacacc agaacataat
      661 tcttgtgacc tcaaatttga gcccgtcctt cgagaagagt gcatttcagc cgattgggca
      721 gaaaagtttt tctggaactc agagtttaag gattgtgagc cattctggta tgactcttca
      781 tgcgatccac gtgaccgagc tgggaagaac tttttcgaaa cttttgaaga ttgcaaaaat
      841 aaatgtgatg gcgtccaatc tcaatatgtg gtaccaatta caactgttcc cgatgaacaa
      901 agcaaaattg aggaagttga aacatcagaa acacctggaa ttgttgatga gactacaact
      961 acagcagccc cggaagagga aagcgaggag aacggatttt tcttcaaagt aaaaccacaa
     1021 aactatctgg aagatgtttt gagttccgag acagaggaaa ctcaacatta tgggttcaat
     1081 cccaacgagt ttttgaaaca aaattctcaa aatcagaaac ctaccgagat tactgagata
     1141 ctgagaattc ttcccgctca aactgaacac gacgaggctt ctgagttgaa gaaagaagat
     1201 aaaattgagc acgatatttt ggaacatctt aaaaataaag agcccactga aaaagtgtta
     1261 tcaactccgt caacttgtga tttggaatat gacgatgcct tgagaaatga atgcacttcg
     1321 gcagactgga ccgagttgta ctattggaat gcacagttca aggaatgcga agcattttgg
     1381 tacgattcct cttgtggaga tcaagatttt agcaaaaaaa atttgttcaa gaatttcgat
     1441 gattgtaata atcaatgtgt gaagaaaatt ggagaagctt taaaaaaaat ggatcctgaa
     1501 acaactacaa caacatccac tactacaact actactactg cacctaccac aacaaaaatg
     1561 gaagaaccta aacgttccaa ctacaagcaa agtgatccat taaacttaat tttgaataaa
     1621 gctctaaatc cggatgagtc ctcagaatta ccagagaagt ttccgccagc tcacgagcaa
     1681 ggcttcgtta acttcgcaat aaaatcagaa gtcacagcta ctactaaatt cgacagattg
     1741 aaatacatgg ctgagttcag aaagaaatta ctggcacttc ctgataattt ttctacaact
     1801 ccaaaacaat cttctcctac ttcttctcct accacaactc gtatgcgcag tccttccact
     1861 cacaagtcaa ctgtctcaca agctacaaag actgcatctt ccacgccgca aagtccttcg
     1921 accactacaa gctttgatga ctttgttgag aaagagaaga aaactgttct agagactata
     1981 aagattctag atcgcccaga ggatctttgc gacgagcccc ttcatccaaa gcttgaggaa
     2041 gattgcaaaa atgatcagtg ggaaattcag tggtttttca attctgatcg aggtgcttgc
     2101 aagtcgtttt ggtacggagg ttgcgagatt gagagtagaa acttctttcc tgatcatgcg
     2161 aactgtcgac attcctgtgc tcacaagtat gctacacctg caagtttctc atcgaaagtt
     2221 tacattccgc ccggcgagtt gagcactcct gttcctcccc gtaaagatcg tcttaccact
     2281 agcctgaagc ttacttaccc tcactccgaa gatttgtttc cttcagaaga acactcaaca
     2341 gtagttgaac tagacgggaa tttccagcgt acagaaaaac aggaacgcat acgccttttt
     2401 ccaacaaaaa catttagacc aagagcccct acgccaactg cttcaaatat tgtcaatgtt
     2461 tctgaaggag aaaaaactga aacggctcca gccttctaca gccatattga tcgagtcgtc
     2521 cacgacatga aaacaggaga acacccggga tatacaaaac cagaagagtt tgtaagaaga
     2581 attgaatctg cgagcaatga ctatatcaaa tatgacttgc aaaaaccaga cgtagttact
     2641 attatcgaca aatctccacc tacggtacca tcaagaaaag aaagaactga aagaacagaa
     2701 gtaaccacaa aattaccatc gactcgatca ataaatgatc catgcgatga cgagtatgat
     2761 ccgaaatggg atgaagactg tctaggggac acttgggttg tcagaagcta ttacgattcg
     2821 aaggctgaaa aatgcaaagc tttttggtat ggaggatgcc acactagtag cagaaatatt
     2881 tggtttgata aggagacatg tcgaacttcg tgtgctcaca aattccccac cgacatgccc
     2941 atgtatggag gtgcacaatc ttcggaagtg tctgccgaaa ttttgccgtc tcctcaagaa
     3001 gaaaattcat cgaaagaaac ttcatcatcg tcttcgtctt catcttcttc taacacggca
     3061 cacatctcac cggagcatcg attcaaagtg gacctcgatc agaagtttgc tgatgttaaa
     3121 cgggaacatg agggcagaga ggatttagca tattcgcaaa tggttcagca tcctgttaca
     3181 gtttcagctg attgcttaga agtgtacaat gcaagtttgt caaaaccgtg tggagatgga
     3241 aaatcttgga gcaacagata tttctacgac aaagacactc gctcttgtcg catgttttgg
     3301 agcaacggat gcttcagctc atcgaaaaac aattttgatg acttagaaac ttgccagtgg
     3361 aagtgtgaag gaagacatcc acaacctgca ggaaaatctt gtttggacaa atttgatgaa
     3421 cgatatctgg aggactgtag acatggagaa tttacgaatc gattttattt tgatcatgac
     3481 cggaagaagt gtgttgcatt ccattgggga ggctgtcaat cgaaatcgca aaactttttc
     3541 gctgatatga cagtttgcca agatctctgt gaatctccac cgagagagtt gacacaagct
     3601 tgtctgcaac cattcgatac cacgtatgag acatcgtgct cagctgagaa acctcagcaa
     3661 tattactatt ttgacatgtc ttctggaatt tgcaaaatgt tctggtttgg aaattgcaag
     3721 ggagagaatc aaaacatctt tagcaccttg gaggcttgcc aatggatctg tgagagaaaa
     3781 cgtgacgaaa ggaaaccagc aatttgtgct gacaagtttg acacaaagta cacggaatct
     3841 tgcggagact ctcaatggac tgagaaatgg tatttcgatc aatcatccgg agactgttca
     3901 tcgttctggt gggatgaatg cacttcctcg tctcaaaata ttttcccaga tgagaagtcg
     3961 tgtacctcaa attgcaaaca tcctggattt gaaatttcgt caaagctggc tacagaggaa
     4021 tcaaaattca gatgccttga gccggttgaa atcggatctt gccaagaaac atatcctgca
     4081 ttttactacg accgagcgtc acgtacgtgt cgtccatttg cctattctgg ttgcggagga
     4141 aattcgaatc gtttcatgac agtttctcag tgtgaaaact tgtgttttgc atttaattcg
     4201 atgaatgaag ccgaagtaga ctgtcatctt cccatgcaca ttggttatgg aaagaatgag
     4261 gacagttgcc tgccgcaagc cggattcaga ttctattatg ataggaatta tggtaaatgt
     4321 tcccagatgt ggtatctggg ttgtggtggg aatgcgaaca atttctactc gtatgaaatc
     4381 tgccagcgaa catgctcaca gtcagacgtg cctcgggaac tggaacgaaa gactcgagca
     4441 agcagcgagg tttgtttcga gcctccggga gatcgtggca tttgcggtaa gaactcaagc
     4501 accaatccac ttaaacgatg gacatatggt aatcagaaat gtacatcatt tacttattct
     4561 ggctgcggag gaaatcgaaa tagatttgca acacaggata tatgtgaaaa tacatgtaat
     4621 gggcttatga acagtaatga ccctcgtatt tgctcgttct cgcccgattg gggttcttgt
     4681 aatcagcttc gctatgtttg gttctacaat ttgacccgtg gaacctgcga tcaatttctt
     4741 tacggtggct gtggaggaaa tccaaatcgc ttcgacactt ttgaaatttg tcaaaaagcg
     4801 tgtgaagtca ctggaacaga tccgtgtatg gaatctttgg atcgtggaag ttggtgtgag
     4861 gcaatgtcaa atagatatta ttttaacaag agagcacgcc aatgcaaagg atttcactac
     4921 accgggtgtg gaaaaagtgg aaataatttt ttgacaaaag aagagtgtca gacaaaatgt
     4981 gagaaacgtt ttccgcgtgc agcgccgtca aaaaagaagg cgaaggttaa actaccagtt
     5041 ggatattccg gtgcaaagcc gaaagataaa acgccaatgc tacggcacat caatttgaat
     5101 ggaaataatc aaacatattt caaatccgag cctcaatgga tggactattc ctcttgttat
     5161 ggttacaggt acaatgtaac tggacgagac actattctga atgttcatta ttgtgcaatt
     5221 cgtggctctg cagactgcat cagtgaaagt tataggtcta cggaggggga ggagtactgt
     5281 aatatcttga gaccatttct acgaggccaa aacttatact ctttctattt tggattagat
     5341 tcagtgaatc caatgtaccg cccaaaggat gggctctccg gaagaattca acggaaaaac
     5401 gaaacgattg ctgccgttct tgtattgaaa gctaaccagt gccatgaaat ttgctag
//