Dbfetch

LOCUS       NM_001028218            4413 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Rap guanine nucleotide exchange factor
            (pxf-1), partial mRNA.
ACCESSION   NM_001028218
VERSION     NM_001028218.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4413)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4413)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4413)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4413)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Jun 26, 2012 this sequence version replaced NM_001028218.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..4413
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>4413
                     /gene="pxf-1"
                     /locus_tag="CELE_T14G10.2"
                     /db_xref="GeneID:177894"
                     /db_xref="WormBase:WBGene00004254"
     CDS             1..4413
                     /gene="pxf-1"
                     /locus_tag="CELE_T14G10.2"
                     /standard_name="T14G10.2a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Rap guanine nucleotide exchange factor"
                     /protein_id="NP_001023389.1"
                     /db_xref="GeneID:177894"
                     /db_xref="WormBase:WBGene00004254"
                     /translation="MDPRKPRQDPVNDARFYESLIKPPHLRTPDDIRNVYEQLRQLDT
                     FSNLFIGPLKALCKTARYERHPAQYILFRDGDVARSWYILLSGSVFIENQIYMPYGCF
                     GKRTGQNHRRTHNCLLLQESEMIVIDYPTEPQSNGMSPRTPPRGIHHSGEPVHQKTPR
                     KSAPNMSVDSIAMPPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIPTTSS
                     SSSNTSYNDQHRSQVYLNGLSADEDTLVRVKHRREKSNSVGGQAQNGISTARRLRGRS
                     TASSTTTEGETASNEGADSDEDEGSMPSQESSSGGFMDLRDSVRECLEKEPSERNSED
                     LAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLDSWSVIVNGC
                     VEVVKPSGERVEYKLGDSFGAEPTPATQIHIGEMRTMVDDCEFVLVEHRDFCSIMSTI
                     GDHIEKDRDGLTGEVVSEVERRTVGTHCGQVLIKGKPDKLIHHLVDERDHNVDPHYVD
                     DFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLLWVNNHFNDFETNDEMWNLL
                     ERFEGALERDGMHSQLSLLNIACSVKAKPRQVILTRRKDDKMMMRLVGGQESGNSVYV
                     AEVFPDTSAAREGVKRADEMLEVNQQSAKYLSAKKAEDLLTGSLSLTLMLKNNVLGYK
                     ETIGKIEHNKPKNGTSRSGAGIPMVIPVHKTSITGKKSSTTSSKSGMMEKLMTILKSS
                     KEDSMDFTDEAKISSADLRPSRSNPDITSISQYYGPVRSECPEHVLKIYRNDQTFKYL
                     PVYKETSAQNVVQLALQEFNMTAEGSPEWSLCECTVTIDGVIKQRRLPPQMENLAERI
                     ALNSRYYLKNNSRSEPLVPDELAPELLKEAQTQLLSLNAQVVAAQLTLQDFSVFSAIE
                     PTEFLDNLFKLDSKYGSPKLEEFEQLFNREMWWVATEICTERHVQKRAKLIKKFIKVA
                     RYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKY
                     RQHLAEVAQEPPVVPIYPVIKKDLTFAHDGNATYSEKLINFEKLRLIAKSIRGVMKLS
                     SAPYEIASMAERSGGVVMDALLHMNSFENSNVATMRKGMSGKQNQPRKKVYEQALMVR
                     KVKSYLEGLHVVDNEMELDSMSYDIEPQVQTAHRGANSSSTANIRRVPSPTPSSLSSQ
                     SAGSADQSSRHRLLFNGTGSISSAGGGSKFGVESPQAVQKMLSLVQNSKVKGAPPQIT
                     SPSTSARSSLQRNMPRVTGRQATSSAQGPVQLNEETSTVTTYYQSDNGRRQRSGSEGR
                     FDNIPPSTFYLTSDGLTVSPRQSLSVVIPTHPHGHSPTSPRCRSRSPASSGCSSFSTI
                     ASIAATSMAAAPSAFVSNPYQHHQTVRGHVIGHRPMPIVTSGSATLPNHVSPRGLPPK
                     SRPTILPGSHTNSSSRMGTIKEATFLTSEQVSRV"
ORIGIN      
        1 atggatcctc ggaaacctcg acaggatcca gtcaatgatg ctcgttttta cgaatccctc
       61 attaaaccac cgcatttaag gacaccagat gatattcgaa atgtatacga gcaattgcgg
      121 cagctcgaca ccttcagtaa tttgtttata ggtccattga aagctctctg taaaactgct
      181 cgatatgaaa ggcatccagc acaatatatt ctttttcggg atggagatgt cgcacgaagc
      241 tggtacattc tactatcagg atcagttttt attgaaaatc aaatctacat gccttacggg
      301 tgctttggca agcgaacagg acaaaatcat cgaaggactc ataattgtct gctgttacaa
      361 gaatctgaaa tgattgtgat tgactatcca acggaacccc aatcgaatgg aatgtcacca
      421 cgaacacctc ctcgaggaat tcatcattca ggagaaccag ttcatcagaa aactcctaga
      481 aaatcggcac caaatatgtc agttgattca attgcaatgc cgccacctcc agttccacct
      541 cgtcctctac gtcttccaca aactgcagct aaaggcccag ctcctctgcc gccacgtggt
      601 ttacctagaa catatccatt ggattttcct gtagatattc caacaacgtc atcatcatca
      661 tcaaacactt catataatga tcaacatcgt agtcaagtat atttgaatgg attatccgct
      721 gatgaagata ctcttgttcg agtgaagcat agaagagaga aaagcaattc agttggagga
      781 caagcccaga atggaatttc aactgctcgg aggcttcgag gaagaagcac agcatcatct
      841 acaactactg aaggtgaaac agcttccaac gaaggagcag attcagacga agatgaaggg
      901 agtatgcctt cacaagaatc aagtagtgga ggattcatgg atctgcgaga ttctgtccga
      961 gaatgtcttg aaaaggaacc ttcagaacga aattcagaag atcttgcagt tttactcgat
     1021 ttcatgcaac atatgtccgc atttgccgct ttgccgatgt caataaaacg tcagttatgc
     1081 ttgaaaatgg tttttgcggt agtaaacgat gcgggtacgg tagttcttgc tcacaacgag
     1141 aaactcgatt catggtctgt aatagtgaat ggatgtgtag aagttgtaaa accatctggt
     1201 gagcgtgttg aatacaagct cggagattca tttggtgcag aaccaacacc tgcaacacaa
     1261 attcatatcg gtgaaatgag aacaatggtg gatgattgtg aattcgtact tgttgaacat
     1321 cgagattttt gttcaattat gtcgacaatt ggtgatcata ttgaaaaaga tcgagacggt
     1381 ttgacaggag aagttgtgtc agaagttgaa cgaaggactg ttggaactca ttgtggacaa
     1441 gtgcttatca aaggaaaacc agacaaatta atacaccatt tagtggatga acgagatcat
     1501 aatgttgatc cacactatgt cgacgatttt ctattgacct atcgagtttt cataagagat
     1561 ccaactacga ttttcgagaa attgatgctc tggtttgccg attctatata tcgagataaa
     1621 gttgcaagat tggttcttct atgggttaat aatcatttta atgatttcga gacgaacgat
     1681 gagatgtgga atctattaga acgttttgaa ggagcattag aaagagatgg aatgcattct
     1741 caactatctt tattgaatat tgcatgttct gtaaaagcaa aacctcgaca agtgatatta
     1801 acaaggagaa aagatgacaa aatgatgatg agattagttg gaggtcaaga atcaggcaac
     1861 tctgtatacg tggccgaagt cttcccagat acgtcagcag cgagagaagg tgtgaagaga
     1921 gctgatgaaa tgttagaagt gaatcaacaa tcagctaaat atttatcagc caaaaaagcg
     1981 gaagatctac taacggggtc tctgtcatta actttgatgc tcaaaaataa tgttcttggg
     2041 tacaaggaga caattggaaa aattgaacat aataagccta aaaatggaac atcaagatct
     2101 ggtgccggaa ttccaatggt aattccagtt cacaaaactt caataactgg aaagaaatca
     2161 tcgacgacaa gtagcaaatc gggtatgatg gaaaaattga tgacaatatt gaaatcatca
     2221 aaagaagatt caatggattt cactgatgaa gctaagatat catcagccga tcttcgtcca
     2281 agtcgatcca atcctgatat cactagcata tcacagtact acggaccagt acgaagcgaa
     2341 tgtcctgaac acgttctgaa gatttatcga aatgatcaga cattcaaata tctgccagtt
     2401 tacaaagaaa cgtctgctca gaatgttgta caactggcat tgcaagagtt taatatgaca
     2461 gcagaaggaa gtccagaatg gtcactttgt gaatgtactg ttacgattga tggagttata
     2521 aaacagagaa ggttaccacc acaaatggaa aatttggctg aaagaatagc tttgaattcg
     2581 agatattatc tgaaaaacaa tagtcgatct gaacctcttg tacctgatga attggctccc
     2641 gaacttttga aagaggccca aactcaactg ctcagtttaa atgctcaagt cgttgctgct
     2701 caactaactt tgcaagactt ttcagttttt tcagcaattg aaccaacaga atttctagat
     2761 aacttattca agctggattc caagtacggc tccccaaaac ttgaagaatt cgaacagtta
     2821 ttcaatcgtg aaatgtggtg ggtggcgaca gagatttgca cagaaagaca tgttcaaaaa
     2881 cgtgcaaaac tgattaaaaa gtttataaaa gtggcgagat attgtcggga tcttcgaaat
     2941 ttcaattcaa tgtttgctat tatgagtgga cttgataagc cagcagttcg taggttgcat
     3001 tccagttggg aacgggtttc gagtaaatac attcgtatgc ttgatgaaat ccatcaactt
     3061 gtcgatcctt ctcgtaatat gtcaaagtat cgtcaacatc ttgctgaagt cgcccaagaa
     3121 ccgcctgttg tcccaattta tcctgtaatc aaaaaagatc tcacatttgc tcacgatggt
     3181 aatgcaacat attctgaaaa actaatcaat ttcgagaagc ttcgacttat tgcaaaatca
     3241 attcgaggtg taatgaaatt gagtagtgca ccttatgaaa ttgctagtat ggcagagagg
     3301 agtggtggag ttgtaatgga cgctcttctt catatgaatt cattcgaaaa ttcaaatgta
     3361 gccacaatga ggaagggaat gagtggaaaa cagaatcagc cacgaaaaaa agtttatgaa
     3421 caagctctta tggtacggaa agtgaaatca tatctcgaag gattacatgt tgttgataat
     3481 gaaatggaat tggattcaat gagttatgac attgaaccac aagttcagac agctcaccgt
     3541 ggtgctaatt catcatcgac tgcaaatatt cgtcgtgttc catctccaac tccatcgtca
     3601 ctttcctctc aatcagccgg gtcagccgat caatcatctc ggcatcgtct tcttttcaat
     3661 ggaaccggct caatttcgtc agctggtggt ggttctaaat ttggagtcga atctccacaa
     3721 gctgtacaaa aaatgctgtc acttgttcag aattccaaag ttaaaggtgc tccacctcaa
     3781 atcacatctc catccacatc agcaagatcc tctcttcaac ggaatatgcc acgtgtaact
     3841 ggtcgacaag cgacatcctc ggctcaaggg ccagttcaac tgaatgaaga gacgtctacg
     3901 gttacgacat attatcaatc agataatggg cgccggcaac gatctggatc cgaaggaaga
     3961 tttgataata ttccgccatc aaccttctat ctaacatccg acggtcttac tgtatcaccc
     4021 agacaatcgt tgtctgttgt gattccaaca catcctcatg gccactctcc aacatcgcca
     4081 cggtgccgct cgcgatcacc ggcatcttcc gggtgttctt ccttctccac cattgcctca
     4141 atcgccgcta cctcgatggc agccgcacct tcggcatttg tctccaatcc gtaccaacac
     4201 caccaaaccg tccgtggaca tgtcatagga catcgtccaa tgccaatcgt cactagtggt
     4261 tcagccacac tcccgaatca tgtttctcca cgaggtttac caccgaaatc tcgtcctaca
     4321 atcctacctg gttcacacac caattcttca tcaagaatgg gtactatcaa agaagctaca
     4381 ttcctgacat ctgaacaagt atcgcgagtt taa
//