Dbfetch

LOCUS       NM_001027625             729 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Histone-lysine N-methyltransferase set-1
            (set-1), partial mRNA.
ACCESSION   NM_001027625
VERSION     NM_001027625.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 729)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 729)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 729)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 729)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_001027625.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..729
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>729
                     /gene="set-1"
                     /locus_tag="CELE_T26A5.7"
                     /db_xref="GeneID:175918"
                     /db_xref="WormBase:WBGene00004781"
     CDS             1..729
                     /gene="set-1"
                     /locus_tag="CELE_T26A5.7"
                     /standard_name="T26A5.7a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Histone-lysine N-methyltransferase set-1"
                     /protein_id="NP_001022796.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004781"
                     /db_xref="EnsemblGenomes-Tr:T26A5.7a"
                     /db_xref="GeneID:175918"
                     /db_xref="WormBase:WBGene00004781"
                     /translation="MKVAAKKLATSRMRKDRAAAASPSSDIENSENPSSLASHSSSSG
                     RMTPSKNTRSRKGVSVKDVSNHKITEFFQVRRSNRKTSKQISDEAKHALRDTVLKGTN
                     ERLLEVYKDVVKGRGIRTKVNFEKGDFVVEYRGVMMEYSEAKVIEEQYSNDEEIGSYM
                     YFFEHNNKKWCIDATKESPWKGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQG
                     EELLYDYGDRSAETIAKNPWLVNT"
ORIGIN      
        1 atgaaagttg ccgcgaagaa gctggcaacg agtagaatgc gaaaggatcg tgccgcagca
       61 gcgtcaccat ctagtgatat tgagaactcc gaaaatccat cgtctttggc ttcacactct
      121 tcatcttcag gaagaatgac accgtcgaaa aacacaagga gcagaaaagg agtgtcggtg
      181 aaagatgtct caaaccataa aatcacagaa ttcttccaag tgcggcgaag taatcggaag
      241 acgagcaagc aaattagcga tgaagctaaa catgctcttc gcgataccgt actcaagggg
      301 actaatgaac gacttcttga agtgtacaaa gatgttgtga aggggcgagg aattcgaacg
      361 aaagttaact ttgaaaaagg agactttgtt gtcgaataca gaggtgttat gatggagtac
      421 tcggaagcaa aagtgataga agaacaatat tcgaatgatg aggaaatcgg atcctacatg
      481 tacttttttg agcacaacaa taaaaaatgg tgtatcgatg cgacaaaaga atctccatgg
      541 aaaggacgac tcatcaatca ttccgtgtta aggccgaatc tcaaaacgaa agtggtggaa
      601 atcgatgggt cgcatcacct gattctcgtc gccaggcgtc aaatcgcaca aggagaagag
      661 cttctctacg attatggaga tcgttcagca gagacgattg ccaagaatcc atggcttgtg
      721 aacacataa
//