Dbfetch

LOCUS       NM_001027545             453 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), partial mRNA.
ACCESSION   NM_001027545
VERSION     NM_001027545.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 453)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 453)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 453)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 453)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_001027545.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..453
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>453
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             1..453
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2c"
                     /note="Product from WormBase gene class sup;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001022716.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2c"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:Q7Z204"
                     /db_xref="UniProtKB/TrEMBL:Q7Z204"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGHS
                     MNNPEMLQRMQYPQVYQSYYGYHPAAVYQQHYDVNSLASQMGGMHVGGGNPQANGGGD
                     MYGAHMYGQNAGGQGGQGVGQGGQGGNQQFYNPNNGRNKKYFQPMNPQ"
ORIGIN      
        1 atgaacgcat cttcggctcc acaacaacaa cagcaacaac agcagccaca acaagggcaa
       61 gctccccagc aacaacaaca gggaccacca caacatcaat atcaacaaca acgcccattc
      121 catggacact cgatgaacaa tcctgaaatg ctccagcgaa tgcaatatcc acaagtctat
      181 caatcgtact atggatacca tccagctgca gtctaccaac aacactatga cgttaactcg
      241 ttggcttcac agatgggcgg tatgcatgtc ggtggtggaa atccacaggc gaatggtgga
      301 ggtgacatgt atggagcaca tatgtacgga cagaatgccg gtggacaagg tggacaagga
      361 gtcggacaag gcggacaggg tgggaatcaa cagttttaca acccgaataa tggacgcaac
      421 aaaaagtatt tccagccgat gaatccacaa taa
//