Dbfetch

LOCUS       NM_001027041            1841 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Aldedh domain-containing protein (alh-6),
            mRNA.
ACCESSION   NM_001027041
VERSION     NM_001027041.6
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1841)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1841)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1841)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1841)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Sep 4, 2019 this sequence version replaced NM_001027041.5.
FEATURES             Location/Qualifiers
     source          1..1841
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            1..1841
                     /gene="alh-6"
                     /locus_tag="CELE_F56D12.1"
                     /db_xref="GeneID:173510"
                     /db_xref="WormBase:WBGene00000112"
     CDS             4..1188
                     /gene="alh-6"
                     /locus_tag="CELE_F56D12.1"
                     /standard_name="F56D12.1c"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Aldedh domain-containing protein"
                     /protein_id="NP_001022212.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00000112"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1c.1"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1c.2"
                     /db_xref="EnsemblGenomes-Tr:F56D12.1c.3"
                     /db_xref="GeneID:173510"
                     /db_xref="GOA:Q6A593"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:Q6A593"
                     /db_xref="WormBase:WBGene00000112"
                     /translation="MLSFAARRSLITQKCAASTYSGLTSADFLKKKTNEPILEYRKGS
                     KERQDLEAALAFYSKNITEVPLRIGDKKITNKLEQKQVIPSDHRSTLAKYTYATGEQI
                     QEAIDVALQARGAWERKPLKERAEILLRAADLAAGKYRMKLNASTMLGQGKNIIQAEI
                     DAACELIDFFRFNAVFAMELEHYEPISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGN
                     LPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPSDGPVFGDVITAS
                     PHLSAVNFTGSVPTFKTIWRKVAENLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAA
                     GTARSAWEYSGQKCSACSRMYAPKSIWPKILEKISAIHKEIKLGDFTGSRWIRLSVGC
                     DR"
ORIGIN      
        1 aaaatgctct cattcgcagc tcgacgctcc ttaatcacac aaaaatgcgc cgccagcacg
       61 tacagcggtc taacatcggc ggattttctc aaaaagaaga caaatgagcc gattttagag
      121 tatcgaaaag gaagcaaaga acgacaggat ttggaggcag cgttggcgtt ctacagcaag
      181 aacatcacag aagttccatt gagaattggc gacaagaaaa tcacgaataa attggagcag
      241 aagcaagtta ttccctctga ccatcgttca acacttgcca agtacactta tgccaccgga
      301 gagcaaattc aagaagccat cgatgtggct cttcaggcga gaggcgcctg ggagagaaaa
      361 ccgcttaaag aacgagctga aattttgctc cgcgccgccg atttggccgc tggaaagtac
      421 cgaatgaagc tgaacgcctc cacgatgctc ggccagggaa agaatattat tcaggctgaa
      481 attgacgccg cctgtgagct catcgatttc ttccgattca acgcggtttt cgctatggag
      541 ctggagcatt atgagccgat ttccacgaaa atcaccaaaa atacgatgca gttccgtgga
      601 atggagggat tcgtcgccgc aatcgcaccg ttcaatttta cggcgatcgg aggaaatttg
      661 ccgactgctc cggcgcttat gggtaacgtc tccctctgga agccatcgaa caccgccgtg
      721 ctctccaatt atataatcta cgaactcctc gaggaagctg gtatgccacc tggaattctc
      781 tcattcttgc catcagatgg ccccgttttc ggtgacgtca tcaccgcatc tccacacttg
      841 agcgctgtca atttcactgg ctccgtgcca actttcaaga cgatttggag aaaagtcgcc
      901 gagaatttgg ataactatgt gacttttccg aaactcatcg gagaatgcgg cggaaaaaac
      961 ttccactttg tgcatccatc cgcccacgtg gacgctgtcg ccgctggaac cgcccgttcc
     1021 gcctgggaat attcgggaca aaagtgctcg gcgtgctcca ggatgtacgc gccaaaatcg
     1081 atttggccaa agattctcga gaaaatctcg gcgattcaca aagagatcaa gcttggagat
     1141 tttacaggtt cgcgatggat ccgtctttct gtcggctgtg atcgatgata aggcgtttgc
     1201 caggctcaag gcctacattg actttgcgaa aaccggagcc gacggagcaa atgtggtgct
     1261 cggcggaaaa tgtgacgaca aaacgggata cttcatcgag ccgaccctga tcactgtgac
     1321 ggatccgaag agcaagcttc tcactgagga aatgttcgga ccggtggtga cggtactggt
     1381 ctacgaggat tcgaaggttg atgaggtgct cgcgactgtg aaagacgcga caccttatgg
     1441 gctgactggc gccgtttttt cgcaggataa ggagttcctt tatagagctc gcgatgttct
     1501 ccgcgacgcc gtcggcaaca tgtacctcaa cgacaaatca actggatcaa tcgtcggcca
     1561 gcagccattc ggaggctcca gattgtccgg aaccaatgat aaggccggtg gcccccacta
     1621 tgggctccga tggacctcgc cgctgacgat taaggagacg tcggtgtcat tgactgactg
     1681 gaaatatcca tcaatggaat aattatgttg tttttttctt ttcatttccg atttttctca
     1741 tattgagaat atagttttct ttttgattag gtcaacaatt attgctttac cactgaattt
     1801 taattttttt tcccccgtga tcgcataata aattttgttt t
//