Dbfetch

LOCUS       NM_181925               1635 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans GEX Interacting protein (gei-4), partial
            mRNA.
ACCESSION   NM_181925
VERSION     NM_181925.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1635)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1635)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1635)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1635)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_181925.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1635
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1635
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /db_xref="GeneID:175195"
                     /db_xref="WormBase:WBGene00001561"
     CDS             1..1635
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /standard_name="W07B3.2d"
                     /note="Product from WormBase gene class gei;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="GEX Interacting protein"
                     /protein_id="NP_871654.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001561"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2d.1"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2d.2"
                     /db_xref="GeneID:175195"
                     /db_xref="GOA:Q8ITW3"
                     /db_xref="UniProtKB/TrEMBL:Q8ITW3"
                     /db_xref="WormBase:WBGene00001561"
                     /translation="MQQNIQYTYSSDPRSGGNQNQQLHGISQFQQNSYQPTTYSNSNA
                     NNFHSSNSATFIPNSVTQTPQRRMGEEKSLVNMLDAYFIDSTTPSTSTSWNNQQPVQM
                     SSIQQSVGSYNQQIPQLKVGDVDLQVEGMNVKLSSSPDKGEKDRVKKARQAEAARMRY
                     HRLSNEEKRELNLKRTLAQKRKRQREKEMEELESILRETNDIQEDPDITEQLREKRMR
                     AKWAEAARTRYARMTPEERRAHNTRRRMRQMQNAMSAIKKSEFQACGMATGDPQKDDE
                     AVRLHIKTQNAKKAEAARQRYHRMNDDEKRVYNQRRTEAFRRRRMEEEMLLAMPIGRI
                     NGEALDRAQQIVVRNAKRAEAARLRYQRMTPDQRKSYNQKRYTPKRRRNEMDDMISAG
                     QMAVGSSGTITMGTGTPAKKDDMDALSSLERDVVKRTQHAQQILLRQRANQSSGTPRS
                     VTPPPQAYIISNGQQQHQQLVGNQGNNGIGQHQVLHQGHMQQQQIQVSHQQSSQSIPQ
                     NIYTSGMIIQNQGQQQQGQQQQQGQSQQILNNPYRT"
ORIGIN      
        1 atgcagcaga atatacaata cacatacagt tcggatcccc gctcgggcgg taatcaaaat
       61 cagcagctac acggaatatc gcaatttcaa cagaactcct atcagccgac gacgtattca
      121 aattcaaatg cgaacaattt tcattcctct aattccgcaa cttttatacc taattcagtg
      181 acgcaaacac ctcagcggcg gatgggagaa gagaagagtt tagttaatat gcttgacgct
      241 tattttatcg acagtacgac accttcaaca tcaacgtcgt ggaataatca gcagccagtt
      301 cagatgtctt caatacaaca atcagttgga tcatacaatc aacaaatacc tcagttgaaa
      361 gtaggagatg tggacctaca agtagaagga atgaatgtta aactctcctc gtcacccgac
      421 aaaggcgaga aggatcgagt aaagaaggcg cgacaggcag aagccgcccg aatgcgttat
      481 caccgactat caaacgaaga gaaacgagag ttaaacctga aaagaacgtt ggcgcagaag
      541 cgaaaacggc aacgtgagaa ggagatggag gagctcgaat cgattttgcg ggagacaaat
      601 gacattcaag aggatccgga catcaccgaa cagctcagag agaagagaat gcgggccaag
      661 tgggcagagg ccgcccgtac acgttacgct agaatgacgc cggaagagcg ccgggcgcac
      721 aatacgcgga gacgtatgcg gcagatgcag aacgcgatga gcgcgattaa gaaatcggag
      781 tttcaggcat gtggaatggc tacaggagat ccacagaagg acgacgaggc tgtccggttg
      841 cacatcaaga cgcagaatgc gaaaaaagcg gaggcggctc gtcaacgata ccatcgaatg
      901 aacgatgacg agaagcgcgt ctacaatcaa cgaaggacag aagcgttccg ccgccgtcgt
      961 atggaagaag agatgctgct cgccatgcct ataggccgta tcaacggaga agcactggat
     1021 cgtgctcagc agattgtggt ccgaaacgcg aaacgagccg aagcggcacg tcttcgctac
     1081 cagcgaatga cgcctgatca gagaaagtcg tacaatcaaa aacgctacac tccaaagcgt
     1141 cgtcgcaacg agatggacga catgatcagc gccggacaga tggccgtcgg atcctctgga
     1201 accatcacaa tgggcaccgg cacccccgcc aaaaaggacg atatggacgc tctctcctcg
     1261 ttggaacgtg acgtcgtcaa gcgcacacag cacgctcagc agatccttct ccgacaacgc
     1321 gcgaatcagt cgtcgggaac gccacgctcg gttacaccac cgccacaggc ctatataatc
     1381 tcgaatggtc agcaacagca ccaacagttg gttggaaatc agggaaacaa tgggattgga
     1441 cagcaccagg tgctccatca aggacacatg caacagcagc agattcaggt gtcacaccag
     1501 cagtcgtccc aatcgattcc tcagaacatc tacacttctg gcatgattat ccaaaatcag
     1561 ggacaacagc aacaaggcca gcagcagcag cagggacagt ctcaacaaat attgaacaat
     1621 ccttatagaa cctaa
//